BLASTX nr result
ID: Ziziphus21_contig00034690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034690 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009049799.1| hypothetical protein (mitochondrion) [Capsic... 84 4e-14 ref|YP_173381.1| hypothetical protein NitaMp035 [Nicotiana tabac... 79 1e-12 ref|XP_002535525.1| conserved hypothetical protein [Ricinus comm... 71 3e-10 >ref|YP_009049799.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751733|gb|AIG89820.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752071|gb|AIG90157.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 123 Score = 84.0 bits (206), Expect = 4e-14 Identities = 47/74 (63%), Positives = 49/74 (66%) Frame = +2 Query: 29 MFCILFAHSSFRVVRTRGGSSTFKVIAPTPERXXXXXXXXXXXXXXXXXXXXXXXVICLS 208 MFCILFAHSSFRV+RTRGGSSTFKVIAP ER VICLS Sbjct: 1 MFCILFAHSSFRVIRTRGGSSTFKVIAPVLER-----LLLLLFSGSPLLDALRFEVICLS 55 Query: 209 QNKSPSVTAIVDPV 250 QNKSPSVTAIVDP+ Sbjct: 56 QNKSPSVTAIVDPL 69 >ref|YP_173381.1| hypothetical protein NitaMp035 [Nicotiana tabacum] gi|56806544|dbj|BAD83445.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 125 Score = 79.0 bits (193), Expect = 1e-12 Identities = 45/74 (60%), Positives = 47/74 (63%) Frame = +2 Query: 29 MFCILFAHSSFRVVRTRGGSSTFKVIAPTPERXXXXXXXXXXXXXXXXXXXXXXXVICLS 208 MFCILFAHSSFRV+RTRGGSST VIAP ER VICLS Sbjct: 1 MFCILFAHSSFRVIRTRGGSSTLLVIAPVLER---LLLLLFSGSPLLDALRFLFEVICLS 57 Query: 209 QNKSPSVTAIVDPV 250 QNKSPSVTAIVDP+ Sbjct: 58 QNKSPSVTAIVDPL 71 >ref|XP_002535525.1| conserved hypothetical protein [Ricinus communis] gi|223522790|gb|EEF26858.1| conserved hypothetical protein [Ricinus communis] Length = 50 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 255 VDTGSTMAVTEGDLFCDKQMTPNKNLRAANPKKRGEP 145 V+TGSTMAV+EGDLFCDKQMT N NLR+ANPKKRGEP Sbjct: 11 VETGSTMAVSEGDLFCDKQMTQNNNLRSANPKKRGEP 47