BLASTX nr result
ID: Ziziphus21_contig00034600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034600 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium r... 89 3e-16 ref|XP_013442841.1| hypothetical protein MTR_0082s0270 [Medicago... 61 4e-07 ref|XP_003628497.1| NADH-ubiquinone oxidoreductase (complex I), ... 59 1e-06 >gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium raimondii] Length = 250 Score = 89.4 bits (220), Expect(2) = 3e-16 Identities = 52/91 (57%), Positives = 52/91 (57%) Frame = +3 Query: 30 PYLRIQRSPLDVVVTLWLRRLPGSRFMDGFSQRKSLKVNQYQQHVVTS*AWFILSEKKVG 209 PYLRIQRSPLD AW ILSEKKVG Sbjct: 42 PYLRIQRSPLD--------------------------------------AWLILSEKKVG 63 Query: 210 FGGSLISTPPVLVRSGPWSSVSGLPADKISE 302 FGGSLISTPPVLVRSGPWSSVSGLPADKISE Sbjct: 64 FGGSLISTPPVLVRSGPWSSVSGLPADKISE 94 Score = 22.3 bits (46), Expect(2) = 3e-16 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 1 VGIPTCSSFP 30 VGIPTCSS P Sbjct: 33 VGIPTCSSPP 42 >ref|XP_013442841.1| hypothetical protein MTR_0082s0270 [Medicago truncatula] gi|657370805|gb|KEH16866.1| hypothetical protein MTR_0082s0270 [Medicago truncatula] Length = 197 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 216 GSLISTPPVLVRSGPWSSVSGLPADKISE 302 GSLISTPPVL+RSGPWSSVSGLPADKISE Sbjct: 37 GSLISTPPVLIRSGPWSSVSGLPADKISE 65 >ref|XP_003628497.1| NADH-ubiquinone oxidoreductase (complex I), chain 5 [Medicago truncatula] gi|355522519|gb|AET02973.1| NADH-ubiquinone oxidoreductase (complex I), chain 5 [Medicago truncatula] Length = 187 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 216 GSLISTPPVLVRSGPWSSVSGLPADKISE 302 GSLISTPPVL+RSGPWSSVSG PADKISE Sbjct: 19 GSLISTPPVLIRSGPWSSVSGFPADKISE 47