BLASTX nr result
ID: Ziziphus21_contig00034555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034555 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014492521.1| PREDICTED: protein ALTERED XYLOGLUCAN 4 [Vig... 57 4e-06 gb|AFK42435.1| unknown [Lotus japonicus] 56 9e-06 >ref|XP_014492521.1| PREDICTED: protein ALTERED XYLOGLUCAN 4 [Vigna radiata var. radiata] Length = 439 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 104 KDHSLSFTRKLLPWTVYSILPLAIFRLYFYPLHF 3 KD SLS T++LLPWT+Y++LP+A+ RLYFYPL F Sbjct: 8 KDQSLSITKRLLPWTLYALLPIALLRLYFYPLPF 41 >gb|AFK42435.1| unknown [Lotus japonicus] Length = 263 Score = 56.2 bits (134), Expect = 9e-06 Identities = 21/34 (61%), Positives = 30/34 (88%) Frame = -2 Query: 104 KDHSLSFTRKLLPWTVYSILPLAIFRLYFYPLHF 3 KD S+SFT++L+PWT+Y++LP+ + RLYFYPL F Sbjct: 8 KDQSISFTKRLVPWTLYALLPIVLLRLYFYPLPF 41