BLASTX nr result
ID: Ziziphus21_contig00033489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00033489 (218 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112101.1| Pentatricopeptide repeat-containing protein ... 60 6e-07 >ref|XP_010112101.1| Pentatricopeptide repeat-containing protein [Morus notabilis] gi|587946387|gb|EXC32726.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 584 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/62 (46%), Positives = 46/62 (74%) Frame = -1 Query: 215 YVVDLIIEKRYPIIIVVNPNELDGTAGYNSSLKAVGVFTSAQLRNFLTIQSKLQSRTSAL 36 +VV+L+IEKR+ +++VVNPN++ Y+SSL+AVGVF SAQL + +T +S L ++ Sbjct: 522 HVVNLLIEKRHKMVVVVNPNDVYDR-DYSSSLRAVGVFASAQLSDLVTTESNLPREKPSI 580 Query: 35 CK 30 C+ Sbjct: 581 CR 582