BLASTX nr result
ID: Ziziphus21_contig00033360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00033360 (300 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79625.1| hypothetical protein VITISV_035899 [Vitis vinifera] 57 7e-06 >emb|CAN79625.1| hypothetical protein VITISV_035899 [Vitis vinifera] Length = 866 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +1 Query: 10 PFAIVYTKVPNNTIDLMSLPLPH--HQGAATFTENYAQFHRDVQNRIEQANLRYKAAVDA 183 PF +VYT VP + +DL+ LPL H + A F E Q H +V+ +E+ NL YK D Sbjct: 708 PFEVVYTSVPRHIVDLIRLPLSHDVNPNAEEFAERIQQIHLEVKKNLEKVNLHYKIVADQ 767 Query: 184 H 186 H Sbjct: 768 H 768