BLASTX nr result
ID: Ziziphus21_contig00033271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00033271 (203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010111758.1| RING-H2 finger protein ATL47 [Morus notabili... 59 1e-06 >ref|XP_010111758.1| RING-H2 finger protein ATL47 [Morus notabilis] gi|587945199|gb|EXC31620.1| RING-H2 finger protein ATL47 [Morus notabilis] Length = 170 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/47 (65%), Positives = 37/47 (78%), Gaps = 6/47 (12%) Frame = -2 Query: 127 RAFRSGFGDVSV-VERASGGN-----RSMSRDDLEKLPCYDYITKDT 5 RAFR GFG+VSV +ER S G+ SMS+DDLEKLPC+DY+TKDT Sbjct: 42 RAFRRGFGNVSVAMERGSNGSDITGSTSMSKDDLEKLPCFDYMTKDT 88