BLASTX nr result
ID: Ziziphus21_contig00033244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00033244 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011034356.1| PREDICTED: uncharacterized protein LOC105132... 62 2e-07 ref|XP_006375901.1| hypothetical protein POPTR_0013s055901g, par... 61 3e-07 gb|KJB45066.1| hypothetical protein B456_007G287900 [Gossypium r... 60 5e-07 ref|XP_006371156.1| hypothetical protein POPTR_0019s04880g [Popu... 60 5e-07 gb|KJB45065.1| hypothetical protein B456_007G287900 [Gossypium r... 60 6e-07 ref|XP_012070475.1| PREDICTED: uncharacterized protein LOC105632... 60 8e-07 ref|XP_012070474.1| PREDICTED: uncharacterized protein LOC105632... 60 8e-07 ref|XP_002525447.1| endonuclease, putative [Ricinus communis] gi... 60 8e-07 emb|CAN83570.1| hypothetical protein VITISV_041707 [Vitis vinifera] 60 8e-07 ref|XP_010414877.1| PREDICTED: uncharacterized protein LOC104700... 59 1e-06 gb|KDO55072.1| hypothetical protein CISIN_1g023698mg [Citrus sin... 59 1e-06 gb|KDO55071.1| hypothetical protein CISIN_1g023698mg [Citrus sin... 59 1e-06 gb|KDO55070.1| hypothetical protein CISIN_1g023698mg [Citrus sin... 59 1e-06 gb|KDO55069.1| hypothetical protein CISIN_1g023698mg [Citrus sin... 59 1e-06 ref|XP_006443397.1| hypothetical protein CICLE_v10021582mg [Citr... 59 1e-06 ref|XP_006443396.1| hypothetical protein CICLE_v10021582mg [Citr... 59 1e-06 ref|XP_007202422.1| hypothetical protein PRUPE_ppa009743mg [Prun... 59 1e-06 ref|XP_010086594.1| hypothetical protein L484_002837 [Morus nota... 59 2e-06 ref|XP_011622763.1| PREDICTED: uncharacterized protein LOC184214... 59 2e-06 ref|XP_011010126.1| PREDICTED: uncharacterized protein LOC105115... 59 2e-06 >ref|XP_011034356.1| PREDICTED: uncharacterized protein LOC105132505 [Populus euphratica] Length = 272 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHVLP+ARGGEW+WENL Sbjct: 176 QYCSSRENLTIDHVLPTARGGEWKWENL 203 >ref|XP_006375901.1| hypothetical protein POPTR_0013s055901g, partial [Populus trichocarpa] gi|550325037|gb|ERP53698.1| hypothetical protein POPTR_0013s055901g, partial [Populus trichocarpa] Length = 96 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 229 YCSSRENLTIDHVLPSARGGEWEWENL 309 YCSSRENLTIDHVLP+ARGGEW+WENL Sbjct: 1 YCSSRENLTIDHVLPTARGGEWKWENL 27 >gb|KJB45066.1| hypothetical protein B456_007G287900 [Gossypium raimondii] Length = 141 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 205 LSIVILKRYCSSRENLTIDHVLPSARGGEWEWENLK 312 L + I RYCS+R+NLTIDHVLP ARGGEW+WENL+ Sbjct: 106 LVLDISYRYCSARDNLTIDHVLPVARGGEWKWENLE 141 >ref|XP_006371156.1| hypothetical protein POPTR_0019s04880g [Populus trichocarpa] gi|550316809|gb|ERP48953.1| hypothetical protein POPTR_0019s04880g [Populus trichocarpa] Length = 272 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHVLP+A+GGEW+WENL Sbjct: 176 QYCSSRENLTIDHVLPTAQGGEWQWENL 203 >gb|KJB45065.1| hypothetical protein B456_007G287900 [Gossypium raimondii] Length = 208 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 205 LSIVILKRYCSSRENLTIDHVLPSARGGEWEWENL 309 L + I RYCS+R+NLTIDHVLP ARGGEW+WENL Sbjct: 106 LVLDISYRYCSARDNLTIDHVLPVARGGEWKWENL 140 >ref|XP_012070475.1| PREDICTED: uncharacterized protein LOC105632645 isoform X2 [Jatropha curcas] Length = 247 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHVLP ARGGEW WENL Sbjct: 151 QYCSSRENLTIDHVLPIARGGEWTWENL 178 >ref|XP_012070474.1| PREDICTED: uncharacterized protein LOC105632645 isoform X1 [Jatropha curcas] gi|643732621|gb|KDP39717.1| hypothetical protein JCGZ_02737 [Jatropha curcas] Length = 272 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHVLP ARGGEW WENL Sbjct: 176 QYCSSRENLTIDHVLPIARGGEWTWENL 203 >ref|XP_002525447.1| endonuclease, putative [Ricinus communis] gi|223535260|gb|EEF36937.1| endonuclease, putative [Ricinus communis] Length = 275 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHVLP+ARGG+W WENL Sbjct: 179 QYCSSRENLTIDHVLPTARGGQWTWENL 206 >emb|CAN83570.1| hypothetical protein VITISV_041707 [Vitis vinifera] Length = 620 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENLKDIRG 324 RYCSS ENLT+DHVLP ARGGEW+WENL + G Sbjct: 149 RYCSSGENLTVDHVLPIARGGEWKWENLGNXGG 181 >ref|XP_010414877.1| PREDICTED: uncharacterized protein LOC104700959 isoform X3 [Camelina sativa] Length = 245 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENLKDI 318 +YCSSRENLTIDHV+P +RGGEW W+NL++I Sbjct: 182 QYCSSRENLTIDHVIPISRGGEWTWQNLRNI 212 >gb|KDO55072.1| hypothetical protein CISIN_1g023698mg [Citrus sinensis] Length = 210 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHV+P++RGGEW+WENL Sbjct: 182 QYCSSRENLTIDHVVPASRGGEWKWENL 209 >gb|KDO55071.1| hypothetical protein CISIN_1g023698mg [Citrus sinensis] Length = 255 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHV+P++RGGEW+WENL Sbjct: 182 QYCSSRENLTIDHVVPASRGGEWKWENL 209 >gb|KDO55070.1| hypothetical protein CISIN_1g023698mg [Citrus sinensis] Length = 269 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHV+P++RGGEW+WENL Sbjct: 173 QYCSSRENLTIDHVVPASRGGEWKWENL 200 >gb|KDO55069.1| hypothetical protein CISIN_1g023698mg [Citrus sinensis] Length = 278 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHV+P++RGGEW+WENL Sbjct: 182 QYCSSRENLTIDHVVPASRGGEWKWENL 209 >ref|XP_006443397.1| hypothetical protein CICLE_v10021582mg [Citrus clementina] gi|568850808|ref|XP_006479089.1| PREDICTED: uncharacterized protein LOC102614552 [Citrus sinensis] gi|557545659|gb|ESR56637.1| hypothetical protein CICLE_v10021582mg [Citrus clementina] Length = 278 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHV+P++RGGEW+WENL Sbjct: 182 QYCSSRENLTIDHVVPASRGGEWKWENL 209 >ref|XP_006443396.1| hypothetical protein CICLE_v10021582mg [Citrus clementina] gi|557545658|gb|ESR56636.1| hypothetical protein CICLE_v10021582mg [Citrus clementina] Length = 255 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHV+P++RGGEW+WENL Sbjct: 182 QYCSSRENLTIDHVVPASRGGEWKWENL 209 >ref|XP_007202422.1| hypothetical protein PRUPE_ppa009743mg [Prunus persica] gi|462397953|gb|EMJ03621.1| hypothetical protein PRUPE_ppa009743mg [Prunus persica] Length = 279 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSRENLTIDHVLP RGGEW+WENL Sbjct: 183 QYCSSRENLTIDHVLPIVRGGEWKWENL 210 >ref|XP_010086594.1| hypothetical protein L484_002837 [Morus notabilis] gi|587831148|gb|EXB22050.1| hypothetical protein L484_002837 [Morus notabilis] Length = 294 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSSR+NLTIDHV P+ARGGEW+WENL Sbjct: 204 QYCSSRDNLTIDHVYPAARGGEWKWENL 231 >ref|XP_011622763.1| PREDICTED: uncharacterized protein LOC18421442 isoform X2 [Amborella trichopoda] Length = 250 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSS ENLTIDHVLP +RGGEWEWENL Sbjct: 186 QYCSSTENLTIDHVLPISRGGEWEWENL 213 >ref|XP_011010126.1| PREDICTED: uncharacterized protein LOC105115052 isoform X3 [Populus euphratica] Length = 248 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +1 Query: 226 RYCSSRENLTIDHVLPSARGGEWEWENL 309 +YCSS ENLTIDHVLP+A+GGEW+WENL Sbjct: 179 QYCSSHENLTIDHVLPTAQGGEWQWENL 206