BLASTX nr result
ID: Ziziphus21_contig00033218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00033218 (412 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096120.1| hypothetical protein L484_012475 [Morus nota... 101 2e-19 ref|XP_008240482.1| PREDICTED: pentatricopeptide repeat-containi... 100 7e-19 ref|XP_009355981.1| PREDICTED: pentatricopeptide repeat-containi... 98 3e-18 ref|XP_008375033.1| PREDICTED: pentatricopeptide repeat-containi... 98 3e-18 ref|XP_002515835.1| pentatricopeptide repeat-containing protein,... 96 8e-18 ref|XP_004301456.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_014503959.1| PREDICTED: pentatricopeptide repeat-containi... 91 3e-16 emb|CBI40338.3| unnamed protein product [Vitis vinifera] 90 7e-16 ref|XP_002271725.2| PREDICTED: pentatricopeptide repeat-containi... 90 7e-16 gb|KRH17552.1| hypothetical protein GLYMA_14G224400 [Glycine max] 89 2e-15 ref|XP_011000737.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_012066313.1| PREDICTED: pentatricopeptide repeat-containi... 88 3e-15 emb|CAN79811.1| hypothetical protein VITISV_018821 [Vitis vinifera] 88 3e-15 ref|XP_008455181.1| PREDICTED: pentatricopeptide repeat-containi... 87 5e-15 ref|XP_011658790.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 gb|KGN43730.1| hypothetical protein Csa_7G063940 [Cucumis sativus] 87 6e-15 ref|XP_007019744.1| Tetratricopeptide repeat (TPR)-like superfam... 83 7e-14 ref|XP_007019743.1| Tetratricopeptide repeat (TPR)-like superfam... 83 7e-14 ref|XP_004498096.1| PREDICTED: pentatricopeptide repeat-containi... 83 9e-14 gb|KDO53133.1| hypothetical protein CISIN_1g0032732mg, partial [... 82 1e-13 >ref|XP_010096120.1| hypothetical protein L484_012475 [Morus notabilis] gi|587874132|gb|EXB63285.1| hypothetical protein L484_012475 [Morus notabilis] Length = 858 Score = 101 bits (252), Expect = 2e-19 Identities = 50/78 (64%), Positives = 60/78 (76%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNA 60 K+CKSL AK HQQILVQGL +++T LIG Y+A NA HA+ LLE L+PSP +VFWWN Sbjct: 43 KECKSLDCAKFFHQQILVQGLGHHVTDLIGAYMACNAHTHAVVLLEPLEPSPFSVFWWNQ 102 Query: 59 LMRQAVRSGLLKEVLNLY 6 +R+AV SGLL EVL LY Sbjct: 103 FIRRAVGSGLLNEVLGLY 120 >ref|XP_008240482.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Prunus mume] Length = 851 Score = 99.8 bits (247), Expect = 7e-19 Identities = 47/78 (60%), Positives = 58/78 (74%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNA 60 +QC SL+ AK IHQ ILVQGLT+ +T LI Y+A NAP A++LL+ L P P VFWWN Sbjct: 36 RQCNSLLQAKLIHQHILVQGLTHTVTDLIAAYVACNAPSQALALLQRLVPCPSIVFWWNV 95 Query: 59 LMRQAVRSGLLKEVLNLY 6 L+R AVRSGLL +VL L+ Sbjct: 96 LIRSAVRSGLLYDVLCLH 113 >ref|XP_009355981.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Pyrus x bretschneideri] Length = 841 Score = 97.8 bits (242), Expect = 3e-18 Identities = 49/80 (61%), Positives = 58/80 (72%), Gaps = 1/80 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQG-LTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 +QCKSL AK +HQ+ILVQG L + T LI Y+A NAP A+ LL+ L P P TVFWWN Sbjct: 25 RQCKSLPEAKLLHQRILVQGGLAHAATDLIAAYVACNAPSQALGLLQRLVPCPWTVFWWN 84 Query: 62 ALMRQAVRSGLLKEVLNLYH 3 L+R AV SGLL +VLNLYH Sbjct: 85 VLIRTAVGSGLLHDVLNLYH 104 >ref|XP_008375033.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Malus domestica] Length = 845 Score = 97.8 bits (242), Expect = 3e-18 Identities = 49/80 (61%), Positives = 58/80 (72%), Gaps = 1/80 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQG-LTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 +QCKSL AK +HQ+ILVQG L + T LI Y+A NAP A+ LL+ L P P TVFWWN Sbjct: 29 RQCKSLQEAKLLHQRILVQGGLAHAATDLIAAYVACNAPSQALGLLQRLVPCPWTVFWWN 88 Query: 62 ALMRQAVRSGLLKEVLNLYH 3 L+R AV SGLL +VLNLYH Sbjct: 89 VLIRTAVGSGLLHDVLNLYH 108 >ref|XP_002515835.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544990|gb|EEF46504.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 655 Score = 96.3 bits (238), Expect = 8e-18 Identities = 45/79 (56%), Positives = 61/79 (77%), Gaps = 1/79 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYIT-HLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 KQCKS+ + IHQQ +VQGL ++ + +LI TY+A NAP HA+SLL+ L PSP V+WWN Sbjct: 49 KQCKSIFQSHLIHQQAIVQGLLSHFSLNLISTYLALNAPSHALSLLQCLTPSPSAVYWWN 108 Query: 62 ALMRQAVRSGLLKEVLNLY 6 AL+R+AVR GLL+ L+L+ Sbjct: 109 ALIRRAVRLGLLQHSLSLF 127 >ref|XP_004301456.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Fragaria vesca subsp. vesca] Length = 850 Score = 94.0 bits (232), Expect = 4e-17 Identities = 46/80 (57%), Positives = 59/80 (73%), Gaps = 2/80 (2%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILV-QGLTNYITHLIGTYIAANAPQHAMSLLESLQ-PSPPTVFWW 66 KQCKSL+ K +HQ ILV G+++ +THLI Y++ NAP HA+SLLE L P P V+WW Sbjct: 33 KQCKSLLQVKLLHQHILVCGGVSHSLTHLIAAYLSFNAPSHALSLLERLATPRPAAVYWW 92 Query: 65 NALMRQAVRSGLLKEVLNLY 6 N L+R AVRSG L+ VL+LY Sbjct: 93 NVLIRSAVRSGFLEHVLSLY 112 >ref|XP_014503959.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Vigna radiata var. radiata] Length = 853 Score = 91.3 bits (225), Expect = 3e-16 Identities = 42/78 (53%), Positives = 55/78 (70%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNA 60 KQC SL HAK HQQ +VQGL + +THLIG Y+A N+ A+ LLE L PSP +VFWWN Sbjct: 42 KQCNSLTHAKVWHQQSIVQGLLHLVTHLIGAYMACNSTATAIQLLERLPPSPSSVFWWNQ 101 Query: 59 LMRQAVRSGLLKEVLNLY 6 L+R+A+ G ++V L+ Sbjct: 102 LIRRALHLGTPRQVFALF 119 >emb|CBI40338.3| unnamed protein product [Vitis vinifera] Length = 487 Score = 89.7 bits (221), Expect = 7e-16 Identities = 42/77 (54%), Positives = 55/77 (71%) Frame = -3 Query: 236 QCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNAL 57 QCKSL A+ IHQQ+LVQGL + TH+I Y+ N+P A+S+L L PS TVFWWN L Sbjct: 38 QCKSLASAELIHQQLLVQGLPHDPTHIISMYLTFNSPAKALSVLRRLHPSSHTVFWWNQL 97 Query: 56 MRQAVRSGLLKEVLNLY 6 +R++V G L++VL LY Sbjct: 98 IRRSVHLGFLEDVLQLY 114 >ref|XP_002271725.2| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Vitis vinifera] gi|731421471|ref|XP_010661762.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Vitis vinifera] gi|731421473|ref|XP_010661763.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Vitis vinifera] gi|731421475|ref|XP_010661764.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Vitis vinifera] gi|731421477|ref|XP_010661765.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Vitis vinifera] Length = 852 Score = 89.7 bits (221), Expect = 7e-16 Identities = 42/77 (54%), Positives = 55/77 (71%) Frame = -3 Query: 236 QCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNAL 57 QCKSL A+ IHQQ+LVQGL + TH+I Y+ N+P A+S+L L PS TVFWWN L Sbjct: 38 QCKSLASAELIHQQLLVQGLPHDPTHIISMYLTFNSPAKALSVLRRLHPSSHTVFWWNQL 97 Query: 56 MRQAVRSGLLKEVLNLY 6 +R++V G L++VL LY Sbjct: 98 IRRSVHLGFLEDVLQLY 114 >gb|KRH17552.1| hypothetical protein GLYMA_14G224400 [Glycine max] Length = 887 Score = 88.6 bits (218), Expect = 2e-15 Identities = 42/79 (53%), Positives = 59/79 (74%), Gaps = 1/79 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYI-THLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 K+C SL HAK +HQQ ++QGL ++ T+LIGTYIA+N+ +A+ LLE L PSP +VFWWN Sbjct: 70 KECNSLAHAKLLHQQSIMQGLLFHLATNLIGTYIASNSTAYAILLLERLPPSPSSVFWWN 129 Query: 62 ALMRQAVRSGLLKEVLNLY 6 L+R+A+ G ++V LY Sbjct: 130 QLIRRALHLGSPRDVFTLY 148 >ref|XP_011000737.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Populus euphratica] gi|743913644|ref|XP_011000738.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Populus euphratica] Length = 849 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 1/79 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGL-TNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 KQC S+ IHQQ LVQGL T++ T+LI TY+A ++P HA+SLL+SL PSP V++WN Sbjct: 31 KQCNSVSQVNLIHQQTLVQGLITHFSTNLISTYLAISSPSHALSLLQSLTPSPSAVYFWN 90 Query: 62 ALMRQAVRSGLLKEVLNLY 6 AL+R ++R GLL L L+ Sbjct: 91 ALIRCSIRPGLLNHSLALF 109 >ref|XP_012066313.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Jatropha curcas] gi|643736637|gb|KDP42927.1| hypothetical protein JCGZ_23869 [Jatropha curcas] Length = 853 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 1/79 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGL-TNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 KQCK L+ A IHQQ L+QGL T++ +LI TY+A NAP +++SLL+ L S V+WWN Sbjct: 36 KQCKCLLQANLIHQQALIQGLFTHFSINLISTYLALNAPSYSLSLLQRLTASSSAVYWWN 95 Query: 62 ALMRQAVRSGLLKEVLNLY 6 AL+R+AVR G L + L+L+ Sbjct: 96 ALIRRAVRLGFLHQSLSLF 114 >emb|CAN79811.1| hypothetical protein VITISV_018821 [Vitis vinifera] Length = 871 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/77 (53%), Positives = 54/77 (70%) Frame = -3 Query: 236 QCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNAL 57 QCKSL A+ HQQ+LVQGL + TH+I Y+ N+P A+S+L L PS TVFWWN L Sbjct: 57 QCKSLASAELTHQQLLVQGLPHDPTHIISMYLTFNSPAKALSVLRRLHPSSHTVFWWNQL 116 Query: 56 MRQAVRSGLLKEVLNLY 6 +R++V G L++VL LY Sbjct: 117 IRRSVHLGFLEDVLQLY 133 >ref|XP_008455181.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] gi|659110352|ref|XP_008455182.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] gi|659110354|ref|XP_008455183.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] gi|659110356|ref|XP_008455184.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] gi|659110358|ref|XP_008455185.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] gi|659110360|ref|XP_008455186.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] gi|659110362|ref|XP_008455187.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] gi|659110364|ref|XP_008455188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] gi|659110366|ref|XP_008455189.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis melo] Length = 868 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/78 (51%), Positives = 53/78 (67%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNA 60 +QCK+LI+AK HQQI V G T ++ +G YI A A+SLL+ + PS TVFWWNA Sbjct: 51 RQCKTLINAKLAHQQIFVHGFTEMFSYAVGAYIECGASAEAVSLLQRIIPSHSTVFWWNA 110 Query: 59 LMRQAVRSGLLKEVLNLY 6 L+R++VR GLL + L Y Sbjct: 111 LIRRSVRLGLLDDTLGFY 128 >ref|XP_011658790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724390|ref|XP_011658791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724393|ref|XP_011658792.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724397|ref|XP_011658793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724401|ref|XP_011658794.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724405|ref|XP_011658795.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724408|ref|XP_011658796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724411|ref|XP_011658797.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724414|ref|XP_011658798.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724417|ref|XP_004137054.2| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724420|ref|XP_011658799.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] gi|778724423|ref|XP_011658800.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cucumis sativus] Length = 868 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/78 (51%), Positives = 53/78 (67%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNA 60 +QCK+LI+AK HQQI V G T ++ +G YI A A+SLL+ L PS TVFWWNA Sbjct: 51 RQCKTLINAKLAHQQIFVHGFTEMFSYAVGAYIECGASAEAVSLLQRLIPSHSTVFWWNA 110 Query: 59 LMRQAVRSGLLKEVLNLY 6 L+R++V+ GLL + L Y Sbjct: 111 LIRRSVKLGLLDDTLGFY 128 >gb|KGN43730.1| hypothetical protein Csa_7G063940 [Cucumis sativus] Length = 791 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/78 (51%), Positives = 53/78 (67%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYITHLIGTYIAANAPQHAMSLLESLQPSPPTVFWWNA 60 +QCK+LI+AK HQQI V G T ++ +G YI A A+SLL+ L PS TVFWWNA Sbjct: 51 RQCKTLINAKLAHQQIFVHGFTEMFSYAVGAYIECGASAEAVSLLQRLIPSHSTVFWWNA 110 Query: 59 LMRQAVRSGLLKEVLNLY 6 L+R++V+ GLL + L Y Sbjct: 111 LIRRSVKLGLLDDTLGFY 128 >ref|XP_007019744.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 2 [Theobroma cacao] gi|508725072|gb|EOY16969.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 2 [Theobroma cacao] Length = 850 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/79 (46%), Positives = 58/79 (73%), Gaps = 1/79 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYI-THLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 ++CKSL+ AK IHQQ+L+QGL+++ THLI Y+ +A H++SLL+ PSP VF+WN Sbjct: 34 QKCKSLVQAKLIHQQLLIQGLSHHFATHLISAYLTHHASSHSISLLQRFTPSPSAVFFWN 93 Query: 62 ALMRQAVRSGLLKEVLNLY 6 +L+R+++ G +VL L+ Sbjct: 94 SLIRRSLHLGFSHDVLTLF 112 >ref|XP_007019743.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508725071|gb|EOY16968.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 862 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/79 (46%), Positives = 58/79 (73%), Gaps = 1/79 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYI-THLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 ++CKSL+ AK IHQQ+L+QGL+++ THLI Y+ +A H++SLL+ PSP VF+WN Sbjct: 46 QKCKSLVQAKLIHQQLLIQGLSHHFATHLISAYLTHHASSHSISLLQRFTPSPSAVFFWN 105 Query: 62 ALMRQAVRSGLLKEVLNLY 6 +L+R+++ G +VL L+ Sbjct: 106 SLIRRSLHLGFSHDVLTLF 124 >ref|XP_004498096.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Cicer arietinum] Length = 855 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/81 (50%), Positives = 59/81 (72%), Gaps = 3/81 (3%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQG-LTNY--ITHLIGTYIAANAPQHAMSLLESLQPSPPTVFW 69 +QCK +HAK +HQQ +V G +TNY IT+LI +YI+ N+ +A+SLL++L PSP +VFW Sbjct: 36 QQCKPSLHAKLLHQQTIVNGHITNYTKITNLISSYISTNSIPNALSLLQTLHPSPSSVFW 95 Query: 68 WNALMRQAVRSGLLKEVLNLY 6 WN L+RQ++ VL+LY Sbjct: 96 WNQLIRQSLHFNSPHVVLHLY 116 >gb|KDO53133.1| hypothetical protein CISIN_1g0032732mg, partial [Citrus sinensis] Length = 261 Score = 82.4 bits (202), Expect = 1e-13 Identities = 41/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%) Frame = -3 Query: 239 KQCKSLIHAKTIHQQILVQGLTNYI-THLIGTYIAANAPQHAMSLLESLQPSPPTVFWWN 63 +QCKSL IHQQI+VQ LT+ +HLI Y++ NAP A+SLL+ + PSP +VFWWN Sbjct: 45 RQCKSLTQVYLIHQQIIVQNLTHVPPSHLIAAYVSHNAPSPALSLLQRISPSPFSVFWWN 104 Query: 62 ALMRQAVRSGLLKEVLNLY 6 AL+R+AVR L L+ Sbjct: 105 ALIRRAVRLRLPDNAFRLF 123