BLASTX nr result
ID: Ziziphus21_contig00033177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00033177 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011041952.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_010103616.1| hypothetical protein L484_023114 [Morus nota... 65 2e-08 ref|XP_008382731.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 emb|CBI28998.3| unnamed protein product [Vitis vinifera] 58 2e-06 >ref|XP_011041952.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Populus euphratica] gi|743897329|ref|XP_011041953.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Populus euphratica] gi|743897331|ref|XP_011041954.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Populus euphratica] gi|743897333|ref|XP_011041955.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Populus euphratica] Length = 805 Score = 68.9 bits (167), Expect = 1e-09 Identities = 39/88 (44%), Positives = 56/88 (63%), Gaps = 2/88 (2%) Frame = -3 Query: 263 KRCMLLSKLRSWVLCINKTSQFETI-IKNRLQLYCS-SSYSTCSNFLAGKDPSRIATALC 90 K L SKL+++ K +F I +KN QLY S+ S+CS F GKD ++ AL Sbjct: 2 KSFRLTSKLKTFFQFSKKVYKFNNIQLKNLHQLYSPISTKSSCSGFFIGKDSVALSKALS 61 Query: 89 FSESTKSYLLGTQLHACVIKLGHTNDVF 6 F E++KS++LGTQ+H +IKLG ++DVF Sbjct: 62 FCENSKSFILGTQIHGYIIKLGFSSDVF 89 >ref|XP_010103616.1| hypothetical protein L484_023114 [Morus notabilis] gi|587908440|gb|EXB96393.1| hypothetical protein L484_023114 [Morus notabilis] Length = 777 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/62 (48%), Positives = 43/62 (69%) Frame = -3 Query: 191 IIKNRLQLYCSSSYSTCSNFLAGKDPSRIATALCFSESTKSYLLGTQLHACVIKLGHTND 12 +IK+ +LYCS S S C N L KDP IA AL +E++KSY +G+ +HA V+KLG ++ Sbjct: 1 MIKHHFRLYCSGSNSQCFNLLVRKDPVSIANALSIAENSKSYYVGSHIHAHVVKLGLVDE 60 Query: 11 VF 6 V+ Sbjct: 61 VY 62 >ref|XP_008382731.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Malus domestica] gi|657981432|ref|XP_008382732.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Malus domestica] gi|657981434|ref|XP_008382733.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Malus domestica] Length = 802 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = -3 Query: 173 QLYCSSSYSTCSNFLAGKDPSRIATALCFSESTKSYLLGTQLHACVIKLGHTNDVF 6 +LY S S ++ SNF+ ++P+ IA AL SE+ KS LGTQ+H+ VIKLG TND F Sbjct: 28 KLYSSKSCTSSSNFVMAENPTAIAAALSLSENLKSASLGTQIHSRVIKLGFTNDFF 83 >emb|CBI28998.3| unnamed protein product [Vitis vinifera] Length = 732 Score = 58.2 bits (139), Expect = 2e-06 Identities = 36/99 (36%), Positives = 53/99 (53%) Frame = -3 Query: 302 YVLIIETNKKSNTKRCMLLSKLRSWVLCINKTSQFETIIKNRLQLYCSSSYSTCSNFLAG 123 Y L I K S +SKL L NK +++N+ +Y S S + S+ Sbjct: 20 YPLSILQTKYSKGSTVPFVSKLNHLSLFTNK------MLRNQHHVYTSKSCNCSSSLSFR 73 Query: 122 KDPSRIATALCFSESTKSYLLGTQLHACVIKLGHTNDVF 6 DP+ ++TAL S ++K LLG+Q+HA +IKLG ND+F Sbjct: 74 NDPTALSTALTHSANSKCILLGSQIHAQIIKLGFCNDIF 112