BLASTX nr result
ID: Ziziphus21_contig00032315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00032315 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010109447.1| Ethylene-responsive transcription factor CRF... 81 4e-13 ref|XP_007051632.1| AP2/ERF domain-containing transcription fact... 69 2e-09 ref|XP_008233221.1| PREDICTED: ethylene-responsive transcription... 67 7e-09 ref|XP_007219312.1| hypothetical protein PRUPE_ppa018978mg [Prun... 67 7e-09 ref|XP_012481558.1| PREDICTED: ethylene-responsive transcription... 65 2e-08 gb|KJB09693.1| hypothetical protein B456_001G156900 [Gossypium r... 65 2e-08 ref|XP_010559135.1| PREDICTED: ethylene-responsive transcription... 62 2e-07 ref|XP_010661878.1| PREDICTED: pathogenesis-related genes transc... 58 2e-06 ref|XP_002301396.1| hypothetical protein POPTR_0002s16900g [Popu... 57 4e-06 ref|XP_011023226.1| PREDICTED: ethylene-responsive transcription... 57 5e-06 ref|XP_011037631.1| PREDICTED: ethylene-responsive transcription... 57 5e-06 ref|XP_002320179.2| hypothetical protein POPTR_0014s09020g [Popu... 57 5e-06 ref|XP_011023223.1| PREDICTED: ethylene-responsive transcription... 57 7e-06 >ref|XP_010109447.1| Ethylene-responsive transcription factor CRF4 [Morus notabilis] gi|587935650|gb|EXC22517.1| Ethylene-responsive transcription factor CRF4 [Morus notabilis] Length = 294 Score = 80.9 bits (198), Expect = 4e-13 Identities = 48/94 (51%), Positives = 59/94 (62%), Gaps = 12/94 (12%) Frame = -2 Query: 316 WRPL---PLQLESDD---------DGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETT 173 +RPL P QLES + F+LLDS+FL DCL E+PPP +DE+ VP Sbjct: 199 FRPLESKPGQLESGTTSGEKWNLAEDFLLLDSDFLGDCLYKESPPPLFAVDEVG-VPAAI 257 Query: 172 MVWKEEGFGDMSVDLDEDFGSCKWDVDNYFEDHL 71 EE +GD+ VDLD DFGSCKWDVD+YF+D L Sbjct: 258 ---PEEEYGDVLVDLDGDFGSCKWDVDHYFQDPL 288 >ref|XP_007051632.1| AP2/ERF domain-containing transcription factor, putative [Theobroma cacao] gi|508703893|gb|EOX95789.1| AP2/ERF domain-containing transcription factor, putative [Theobroma cacao] Length = 312 Score = 68.6 bits (166), Expect = 2e-09 Identities = 38/82 (46%), Positives = 50/82 (60%), Gaps = 3/82 (3%) Frame = -2 Query: 319 EWRPL---PLQLESDDDGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETTMVWKEEGF 149 EWRP+ P + + DG++L D L D + + P IFLDEM L E + E+ + Sbjct: 235 EWRPVQERPEEPTNLSDGYLLTDPGALCDYFDCDNLAP-IFLDEMRLPEERNL---EQDY 290 Query: 148 GDMSVDLDEDFGSCKWDVDNYF 83 GD+SV LD DFGSC WDVDNY+ Sbjct: 291 GDISVKLDVDFGSCTWDVDNYY 312 >ref|XP_008233221.1| PREDICTED: ethylene-responsive transcription factor CRF4-like [Prunus mume] Length = 287 Score = 66.6 bits (161), Expect = 7e-09 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 2/82 (2%) Frame = -2 Query: 319 EWRPLPLQLESDDDGFVLLDSNFL-EDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGD 143 EWRP+ + S+ D F +S FL DC E E P P IF DEM +VPE M+ K+E F D Sbjct: 207 EWRPVGI---SERDDFGAFESEFLLNDCFEPEAPAP-IFFDEMRVVPE--MLLKDEDFSD 260 Query: 142 MSVDLDEDFGSCKW-DVDNYFE 80 +S+ DF SCKW DV++YFE Sbjct: 261 LSL----DFRSCKWDDVEDYFE 278 >ref|XP_007219312.1| hypothetical protein PRUPE_ppa018978mg [Prunus persica] gi|462415774|gb|EMJ20511.1| hypothetical protein PRUPE_ppa018978mg [Prunus persica] Length = 287 Score = 66.6 bits (161), Expect = 7e-09 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 2/82 (2%) Frame = -2 Query: 319 EWRPLPLQLESDDDGFVLLDSNFL-EDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGD 143 EWRP+ + S+ D F +S FL DC E E P P IF DEM +VPE M+ K+E F D Sbjct: 207 EWRPVGI---SERDDFGAFESEFLLNDCFEPEAPAP-IFFDEMRVVPE--MLLKDEDFSD 260 Query: 142 MSVDLDEDFGSCKW-DVDNYFE 80 +S+ DF SCKW DV++YFE Sbjct: 261 LSL----DFRSCKWDDVEDYFE 278 >ref|XP_012481558.1| PREDICTED: ethylene-responsive transcription factor CRF5-like [Gossypium raimondii] Length = 368 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/66 (50%), Positives = 44/66 (66%) Frame = -2 Query: 280 DGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGDMSVDLDEDFGSCKW 101 D F+L D L D L+S+ P P IF DE+SL ++ + E +GD+S+ LD DFGSC W Sbjct: 306 DEFLLTDPVVLYDYLDSDNPTP-IFFDELSLPEASSNL--EHDYGDISIQLDVDFGSCSW 362 Query: 100 DVDNYF 83 DVDNY+ Sbjct: 363 DVDNYY 368 >gb|KJB09693.1| hypothetical protein B456_001G156900 [Gossypium raimondii] Length = 313 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/66 (50%), Positives = 44/66 (66%) Frame = -2 Query: 280 DGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGDMSVDLDEDFGSCKW 101 D F+L D L D L+S+ P P IF DE+SL ++ + E +GD+S+ LD DFGSC W Sbjct: 251 DEFLLTDPVVLYDYLDSDNPTP-IFFDELSLPEASSNL--EHDYGDISIQLDVDFGSCSW 307 Query: 100 DVDNYF 83 DVDNY+ Sbjct: 308 DVDNYY 313 >ref|XP_010559135.1| PREDICTED: ethylene-responsive transcription factor CRF6-like [Tarenaya hassleriana] Length = 355 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/55 (54%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -2 Query: 232 SETPPPPIFLDEMSLVPETTMVWKEEG-FGDMSVDLDEDFGSCKWDVDNYFEDHL 71 S+TPP P+FL+E+S+ P+T V KE+G GD S +L +DF S +WDVD++F+DHL Sbjct: 300 SDTPPDPLFLEEISVKPDT--VSKEKGESGDFSFELMKDFTSSEWDVDSFFQDHL 352 >ref|XP_010661878.1| PREDICTED: pathogenesis-related genes transcriptional activator PTI6 [Vitis vinifera] Length = 314 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/86 (39%), Positives = 48/86 (55%), Gaps = 1/86 (1%) Frame = -2 Query: 319 EWRPLPLQLESDDDGFVLLDSNFLEDCLESE-TPPPPIFLDEMSLVPETTMVWKEEGFGD 143 EWRP+ +E L +C +E P PI +EM+ +P+ M+ E GD Sbjct: 243 EWRPVEQVME------------MLNECFVNEFQTPAPICFEEMN-IPD--MILAESIGGD 287 Query: 142 MSVDLDEDFGSCKWDVDNYFEDHLVM 65 +SV LDED GSC WDVD Y+ED +++ Sbjct: 288 ISVRLDEDIGSCTWDVDAYYEDSILL 313 >ref|XP_002301396.1| hypothetical protein POPTR_0002s16900g [Populus trichocarpa] gi|222843122|gb|EEE80669.1| hypothetical protein POPTR_0002s16900g [Populus trichocarpa] Length = 305 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/69 (46%), Positives = 43/69 (62%) Frame = -2 Query: 286 DDDGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGDMSVDLDEDFGSC 107 +DD ++ D L++ + E P P IF +E S VP+T + E + D+SV LD DFGSC Sbjct: 241 EDDECLVTDPLCLKEFWDFENPAP-IFFEECS-VPDTVL---REDYADISVHLDGDFGSC 295 Query: 106 KWDVDNYFE 80 WDVD YFE Sbjct: 296 LWDVDKYFE 304 >ref|XP_011023226.1| PREDICTED: ethylene-responsive transcription factor CRF5-like [Populus euphratica] Length = 305 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/69 (46%), Positives = 44/69 (63%) Frame = -2 Query: 286 DDDGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGDMSVDLDEDFGSC 107 +D+ ++ D L++ + E P P IFL+E S VP+T + E + D+SV LD DFGSC Sbjct: 241 EDNECLVTDPFCLKEFWDFENPAP-IFLEECS-VPDTVL---REDYADISVHLDGDFGSC 295 Query: 106 KWDVDNYFE 80 WDVD YFE Sbjct: 296 LWDVDKYFE 304 >ref|XP_011037631.1| PREDICTED: ethylene-responsive transcription factor CRF5-like [Populus euphratica] Length = 315 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/72 (45%), Positives = 44/72 (61%) Frame = -2 Query: 295 LESDDDGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGDMSVDLDEDF 116 L+ DD +++D L++ + E+P P IF +E S VP T + E + DM V LD DF Sbjct: 248 LKGGDDECLVMDPLCLKEFWDFESPAP-IFFEECS-VPGTVL---REDYADMPVHLDCDF 302 Query: 115 GSCKWDVDNYFE 80 GSC WDVD YFE Sbjct: 303 GSCLWDVDKYFE 314 >ref|XP_002320179.2| hypothetical protein POPTR_0014s09020g [Populus trichocarpa] gi|550323806|gb|EEE98494.2| hypothetical protein POPTR_0014s09020g [Populus trichocarpa] Length = 314 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/72 (45%), Positives = 44/72 (61%) Frame = -2 Query: 295 LESDDDGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGDMSVDLDEDF 116 L+ DD +++D L++ + E+P P IF +E S VP T + E + DM V LD DF Sbjct: 247 LKGGDDECLVMDPLCLKEFWDFESPAP-IFFEECS-VPGTVL---REDYADMPVHLDCDF 301 Query: 115 GSCKWDVDNYFE 80 GSC WDVD YFE Sbjct: 302 GSCLWDVDKYFE 313 >ref|XP_011023223.1| PREDICTED: ethylene-responsive transcription factor CRF5-like [Populus euphratica] Length = 305 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/69 (46%), Positives = 43/69 (62%) Frame = -2 Query: 286 DDDGFVLLDSNFLEDCLESETPPPPIFLDEMSLVPETTMVWKEEGFGDMSVDLDEDFGSC 107 +DD ++ D L++ + E P P IFL+E S VP+T + E + D+SV LD D GSC Sbjct: 241 EDDECLVTDPFCLKEFWDFENPAP-IFLEECS-VPDTVL---REDYADISVHLDGDLGSC 295 Query: 106 KWDVDNYFE 80 WDVD YFE Sbjct: 296 LWDVDKYFE 304