BLASTX nr result
ID: Ziziphus21_contig00032055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00032055 (670 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097994.1| PREDICTED: uncharacterized protein LOC105176... 59 4e-06 ref|XP_007032148.1| NC domain-containing protein-related [Theobr... 58 6e-06 ref|XP_002530560.1| conserved hypothetical protein [Ricinus comm... 57 8e-06 >ref|XP_011097994.1| PREDICTED: uncharacterized protein LOC105176787 [Sesamum indicum] Length = 254 Score = 58.5 bits (140), Expect = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -2 Query: 468 VLSSNIQREELKPGDHVYTWRHIYSCAHHGIF 373 VLS+ IQR+ELKPGDH+Y+WRH Y AHHGI+ Sbjct: 4 VLSNKIQRDELKPGDHIYSWRHAYLYAHHGIY 35 >ref|XP_007032148.1| NC domain-containing protein-related [Theobroma cacao] gi|508711177|gb|EOY03074.1| NC domain-containing protein-related [Theobroma cacao] Length = 272 Score = 57.8 bits (138), Expect = 6e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 468 VLSSNIQREELKPGDHVYTWRHIYSCAHHGIF 373 VLS+ I REELKPGDH+Y+WRH Y AHHGI+ Sbjct: 28 VLSNRISREELKPGDHIYSWRHAYIYAHHGIY 59 >ref|XP_002530560.1| conserved hypothetical protein [Ricinus communis] gi|223529898|gb|EEF31828.1| conserved hypothetical protein [Ricinus communis] Length = 266 Score = 57.4 bits (137), Expect = 8e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -2 Query: 468 VLSSNIQREELKPGDHVYTWRHIYSCAHHGIF 373 VLS+ IQR+ELKPGDH+Y+WRH Y AHHGI+ Sbjct: 3 VLSNIIQRDELKPGDHIYSWRHAYIYAHHGIY 34