BLASTX nr result
ID: Ziziphus21_contig00031920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031920 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553989.1| PREDICTED: potassium transporter 4-like [Gly... 62 2e-07 ref|XP_013689829.1| PREDICTED: potassium transporter 4-like [Bra... 58 3e-06 ref|XP_013614025.1| PREDICTED: potassium transporter 4 [Brassica... 58 3e-06 gb|KHN13399.1| Potassium transporter 4, partial [Glycine soja] 58 3e-06 ref|XP_009124820.1| PREDICTED: potassium transporter 4 [Brassica... 58 3e-06 emb|CDY28663.1| BnaCnng05490D [Brassica napus] 58 3e-06 ref|XP_003548040.1| PREDICTED: potassium transporter 4-like [Gly... 58 3e-06 ref|XP_013728182.1| PREDICTED: uncharacterized protein LOC106431... 57 4e-06 ref|XP_013609291.1| PREDICTED: rhomboid-like protein 14, mitocho... 57 4e-06 ref|XP_013609284.1| PREDICTED: rhomboid-like protein 14, mitocho... 57 4e-06 ref|XP_013609279.1| PREDICTED: rhomboid-like protein 14, mitocho... 57 4e-06 ref|XP_013609272.1| PREDICTED: rhomboid-like protein 14, mitocho... 57 4e-06 ref|XP_013609264.1| PREDICTED: rhomboid-like protein 14, mitocho... 57 4e-06 ref|XP_010496894.1| PREDICTED: potassium transporter 4 isoform X... 57 4e-06 ref|XP_010496893.1| PREDICTED: potassium transporter 4 isoform X... 57 4e-06 ref|XP_010496409.1| PREDICTED: potassium transporter 4 isoform X... 57 4e-06 ref|XP_010496408.1| PREDICTED: potassium transporter 4 isoform X... 57 4e-06 ref|XP_010496406.1| PREDICTED: potassium transporter 4 isoform X... 57 4e-06 ref|XP_010496405.1| PREDICTED: potassium transporter 4 isoform X... 57 4e-06 emb|CDY46056.1| BnaC01g35030D [Brassica napus] 57 4e-06 >ref|XP_003553989.1| PREDICTED: potassium transporter 4-like [Glycine max] gi|734432641|gb|KHN46361.1| Potassium transporter 4 [Glycine soja] gi|947045111|gb|KRG94740.1| hypothetical protein GLYMA_19G105900 [Glycine max] Length = 785 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTVA 6 L ++LAFAFV+YPCLVVQYMGQAAFLSKN G+VA Sbjct: 296 LSIRLAFAFVIYPCLVVQYMGQAAFLSKNLGSVA 329 >ref|XP_013689829.1| PREDICTED: potassium transporter 4-like [Brassica napus] Length = 783 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 101 VQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 ++LAFAF+VYPCLVVQYMGQAAFLSKN G++ Sbjct: 295 IRLAFAFLVYPCLVVQYMGQAAFLSKNLGSI 325 >ref|XP_013614025.1| PREDICTED: potassium transporter 4 [Brassica oleracea var. oleracea] gi|923928102|ref|XP_013732930.1| PREDICTED: potassium transporter 4 [Brassica napus] Length = 779 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 101 VQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 ++LAFAF+VYPCLVVQYMGQAAFLSKN G++ Sbjct: 292 IRLAFAFLVYPCLVVQYMGQAAFLSKNLGSI 322 >gb|KHN13399.1| Potassium transporter 4, partial [Glycine soja] Length = 766 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 L ++LAFAFV+YPCLVVQYMGQAAFLSKN +V Sbjct: 278 LSIRLAFAFVIYPCLVVQYMGQAAFLSKNLNSV 310 >ref|XP_009124820.1| PREDICTED: potassium transporter 4 [Brassica rapa] Length = 785 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 101 VQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 ++LAFAF+VYPCLVVQYMGQAAFLSKN G++ Sbjct: 296 IRLAFAFLVYPCLVVQYMGQAAFLSKNLGSI 326 >emb|CDY28663.1| BnaCnng05490D [Brassica napus] Length = 770 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 101 VQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 ++LAFAF+VYPCLVVQYMGQAAFLSKN G++ Sbjct: 295 IRLAFAFLVYPCLVVQYMGQAAFLSKNLGSI 325 >ref|XP_003548040.1| PREDICTED: potassium transporter 4-like [Glycine max] gi|947059022|gb|KRH08428.1| hypothetical protein GLYMA_16G148800 [Glycine max] Length = 785 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 L ++LAFAFV+YPCLVVQYMGQAAFLSKN +V Sbjct: 297 LSIRLAFAFVIYPCLVVQYMGQAAFLSKNLNSV 329 >ref|XP_013728182.1| PREDICTED: uncharacterized protein LOC106431890 [Brassica napus] Length = 314 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 110 FLPVQLAFAFVVYPCLVVQYMGQAAFLSKNTG 15 F+ QLAFAF+VYPCLVVQYMGQ+AFLSKN G Sbjct: 219 FIKKQLAFAFLVYPCLVVQYMGQSAFLSKNLG 250 >ref|XP_013609291.1| PREDICTED: rhomboid-like protein 14, mitochondrial isoform X5 [Brassica oleracea var. oleracea] Length = 495 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 110 FLPVQLAFAFVVYPCLVVQYMGQAAFLSKNTG 15 F+ QLAFAF+VYPCLVVQYMGQ+AFLSKN G Sbjct: 108 FIKKQLAFAFLVYPCLVVQYMGQSAFLSKNLG 139 >ref|XP_013609284.1| PREDICTED: rhomboid-like protein 14, mitochondrial isoform X4 [Brassica oleracea var. oleracea] Length = 503 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 110 FLPVQLAFAFVVYPCLVVQYMGQAAFLSKNTG 15 F+ QLAFAF+VYPCLVVQYMGQ+AFLSKN G Sbjct: 116 FIKKQLAFAFLVYPCLVVQYMGQSAFLSKNLG 147 >ref|XP_013609279.1| PREDICTED: rhomboid-like protein 14, mitochondrial isoform X3 [Brassica oleracea var. oleracea] Length = 529 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 110 FLPVQLAFAFVVYPCLVVQYMGQAAFLSKNTG 15 F+ QLAFAF+VYPCLVVQYMGQ+AFLSKN G Sbjct: 142 FIKKQLAFAFLVYPCLVVQYMGQSAFLSKNLG 173 >ref|XP_013609272.1| PREDICTED: rhomboid-like protein 14, mitochondrial isoform X2 [Brassica oleracea var. oleracea] Length = 579 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 110 FLPVQLAFAFVVYPCLVVQYMGQAAFLSKNTG 15 F+ QLAFAF+VYPCLVVQYMGQ+AFLSKN G Sbjct: 192 FIKKQLAFAFLVYPCLVVQYMGQSAFLSKNLG 223 >ref|XP_013609264.1| PREDICTED: rhomboid-like protein 14, mitochondrial isoform X1 [Brassica oleracea var. oleracea] Length = 612 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 110 FLPVQLAFAFVVYPCLVVQYMGQAAFLSKNTG 15 F+ QLAFAF+VYPCLVVQYMGQ+AFLSKN G Sbjct: 225 FIKKQLAFAFLVYPCLVVQYMGQSAFLSKNLG 256 >ref|XP_010496894.1| PREDICTED: potassium transporter 4 isoform X2 [Camelina sativa] Length = 704 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 L ++LAFA VVYPCLVVQYMGQAAFLSKN G++ Sbjct: 208 LSIRLAFAVVVYPCLVVQYMGQAAFLSKNLGSI 240 >ref|XP_010496893.1| PREDICTED: potassium transporter 4 isoform X1 [Camelina sativa] Length = 796 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 L ++LAFA VVYPCLVVQYMGQAAFLSKN G++ Sbjct: 300 LSIRLAFAVVVYPCLVVQYMGQAAFLSKNLGSI 332 >ref|XP_010496409.1| PREDICTED: potassium transporter 4 isoform X4 [Camelina sativa] Length = 798 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 L ++LAFA VVYPCLVVQYMGQAAFLSKN G++ Sbjct: 300 LSIRLAFAVVVYPCLVVQYMGQAAFLSKNLGSI 332 >ref|XP_010496408.1| PREDICTED: potassium transporter 4 isoform X3 [Camelina sativa] Length = 798 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 L ++LAFA VVYPCLVVQYMGQAAFLSKN G++ Sbjct: 300 LSIRLAFAVVVYPCLVVQYMGQAAFLSKNLGSI 332 >ref|XP_010496406.1| PREDICTED: potassium transporter 4 isoform X2 [Camelina sativa] Length = 826 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 L ++LAFA VVYPCLVVQYMGQAAFLSKN G++ Sbjct: 328 LSIRLAFAVVVYPCLVVQYMGQAAFLSKNLGSI 360 >ref|XP_010496405.1| PREDICTED: potassium transporter 4 isoform X1 [Camelina sativa] Length = 826 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 107 LPVQLAFAFVVYPCLVVQYMGQAAFLSKNTGTV 9 L ++LAFA VVYPCLVVQYMGQAAFLSKN G++ Sbjct: 328 LSIRLAFAVVVYPCLVVQYMGQAAFLSKNLGSI 360 >emb|CDY46056.1| BnaC01g35030D [Brassica napus] Length = 899 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 110 FLPVQLAFAFVVYPCLVVQYMGQAAFLSKNTG 15 F+ QLAFAF+VYPCLVVQYMGQ+AFLSKN G Sbjct: 644 FIKKQLAFAFLVYPCLVVQYMGQSAFLSKNLG 675