BLASTX nr result
ID: Ziziphus21_contig00031875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031875 (276 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007042489.1| Leucine-rich repeat family protein, putative... 56 9e-06 >ref|XP_007042489.1| Leucine-rich repeat family protein, putative [Theobroma cacao] gi|508706424|gb|EOX98320.1| Leucine-rich repeat family protein, putative [Theobroma cacao] Length = 497 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = -1 Query: 132 VLKATKAIKTFASKIECDPVGYTETWKGDDACKYRGFVCAEHPD 1 + KA I+ F ++I DP GY +TWKG++ CKY+GF CA PD Sbjct: 126 IAKAYPVIQNFKTQIFSDPKGYAKTWKGNNVCKYKGFTCATRPD 169