BLASTX nr result
ID: Ziziphus21_contig00031805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031805 (664 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494... 44 2e-11 ref|XP_010098133.1| hypothetical protein L484_026267 [Morus nota... 55 4e-08 ref|YP_009049681.1| hypothetical protein (mitochondrion) [Capsic... 63 2e-07 >ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494761 [Cicer arietinum] Length = 420 Score = 43.9 bits (102), Expect(3) = 2e-11 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -2 Query: 315 KRVSSHFPASYTYYSTLAKLMMKQXXXXXXXXXDVHSW 202 KRVSSHFP S +YYSTLAKLMMK HSW Sbjct: 6 KRVSSHFPESQSYYSTLAKLMMKH-DLDFSADDVFHSW 42 Score = 40.0 bits (92), Expect(3) = 2e-11 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 82 PPPQAELVSRVIGDHFARFG 23 P PQAELVS VIGDHFARFG Sbjct: 54 PTPQAELVSGVIGDHFARFG 73 Score = 31.6 bits (70), Expect(3) = 2e-11 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 110 APDRRRIIGTPTP 72 APDRRRIIGTPTP Sbjct: 44 APDRRRIIGTPTP 56 >ref|XP_010098133.1| hypothetical protein L484_026267 [Morus notabilis] gi|587885713|gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 55.1 bits (131), Expect(2) = 4e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 80 PTPGRVSEPCNRRPFRAVRGALASAA 3 PTPGRVSEPCNRRPFRAVRGAL SAA Sbjct: 124 PTPGRVSEPCNRRPFRAVRGALESAA 149 Score = 30.0 bits (66), Expect(2) = 4e-08 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 111 CARPPTNNRYPHP 73 CA PPTNNRYP P Sbjct: 114 CAGPPTNNRYPTP 126 >ref|YP_009049681.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751825|gb|AIG89912.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751953|gb|AIG90039.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 107 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 98 RRIIGTPTPGRVSEPCNRRPFRAVRGALASAA 3 RRIIGT TPGRVSEPCNRRPFRAVRGAL SAA Sbjct: 38 RRIIGTHTPGRVSEPCNRRPFRAVRGALESAA 69