BLASTX nr result
ID: Ziziphus21_contig00031764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031764 (382 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008340302.1| PREDICTED: uncharacterized protein LOC103403... 57 4e-06 >ref|XP_008340302.1| PREDICTED: uncharacterized protein LOC103403258 [Malus domestica] Length = 1386 Score = 57.4 bits (137), Expect = 4e-06 Identities = 43/105 (40%), Positives = 59/105 (56%), Gaps = 2/105 (1%) Frame = -3 Query: 368 HPASLPLSVDLIPVQEEKSHVS-EDGLQLKSVDMSNHLRELTAPAQEARMHMGLENCKST 192 H P V L+P E+S S +D L L SV SNHLR+ +A +EAR+ +G +CKST Sbjct: 381 HQKVSPPLVHLVPAHHEESDFSAKDSLPLDSVCFSNHLRKDSAH-EEARLLVGSGSCKST 439 Query: 191 GVASSSPMEEKNP-HSFQDTEVGELAFPMARELKNGDTTRSKDCQ 60 +AS+ P++E+ P QD + MA E KN D T KD + Sbjct: 440 VLASNLPVDEEKPCDRSQDFNL------MAPEDKNXDXTIPKDSE 478