BLASTX nr result
ID: Ziziphus21_contig00031745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031745 (426 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276935.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 emb|CBI26127.3| unnamed protein product [Vitis vinifera] 62 2e-07 ref|XP_008232535.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_012069909.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 gb|KDP40035.1| hypothetical protein JCGZ_02033 [Jatropha curcas] 57 4e-06 ref|XP_002516850.1| pentatricopeptide repeat-containing protein,... 57 4e-06 >ref|XP_002276935.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Vitis vinifera] Length = 623 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 426 VNNKVTAFVAGNHSHPVMEESCRILYFLESEMKNPCFVGLE 304 V NKVT FVAGNHSHP MEE C+IL FL+ EM+NP F G + Sbjct: 582 VRNKVTVFVAGNHSHPYMEELCKILNFLKFEMRNPFFSGFK 622 >emb|CBI26127.3| unnamed protein product [Vitis vinifera] Length = 603 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 426 VNNKVTAFVAGNHSHPVMEESCRILYFLESEMKNPCFVGLE 304 V NKVT FVAGNHSHP MEE C+IL FL+ EM+NP F G + Sbjct: 562 VRNKVTVFVAGNHSHPYMEELCKILNFLKFEMRNPFFSGFK 602 >ref|XP_008232535.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Prunus mume] Length = 625 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -1 Query: 426 VNNKVTAFVAGNHSHPVMEESCRILYFLESEMKNPCF 316 V NKVTAFVAG HS+P M E C IL+F+ EM+NPCF Sbjct: 584 VRNKVTAFVAGKHSNPCMNELCNILHFINFEMRNPCF 620 >ref|XP_012069909.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Jatropha curcas] Length = 623 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 426 VNNKVTAFVAGNHSHPVMEESCRILYFLESEMKNP 322 V N+VT+FVAGN SHP ME C+ILYFLE EM+NP Sbjct: 582 VRNEVTSFVAGNRSHPYMENLCKILYFLEFEMRNP 616 >gb|KDP40035.1| hypothetical protein JCGZ_02033 [Jatropha curcas] Length = 593 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 426 VNNKVTAFVAGNHSHPVMEESCRILYFLESEMKNP 322 V N+VT+FVAGN SHP ME C+ILYFLE EM+NP Sbjct: 552 VRNEVTSFVAGNRSHPYMENLCKILYFLEFEMRNP 586 >ref|XP_002516850.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543938|gb|EEF45464.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 623 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 426 VNNKVTAFVAGNHSHPVMEESCRILYFLESEMKNPCFVGLE 304 V NKVTAFVAGNH +P +E + LYFLE EM++PCF G E Sbjct: 582 VRNKVTAFVAGNHLYPYTDELYKTLYFLEFEMRSPCFSGSE 622