BLASTX nr result
ID: Ziziphus21_contig00031730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031730 (204 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097342.1| hypothetical protein L484_010219 [Morus nota... 65 2e-08 ref|XP_008246558.1| PREDICTED: girdin-like [Prunus mume] 57 7e-06 >ref|XP_010097342.1| hypothetical protein L484_010219 [Morus notabilis] gi|587878657|gb|EXB67652.1| hypothetical protein L484_010219 [Morus notabilis] Length = 939 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -2 Query: 203 LELKEKRLNEVDSLIEERSRMIEFNEKHIESLVVLIQENSEELEVKENKFHALNASFGEK 24 L+ K K L V+ LI E+++++E N +H++SL LIQEN EELEVKE ++ + S EK Sbjct: 78 LDSKAKELEGVEKLIGEQAKVLELNLQHVDSLKSLIQENREELEVKEKQYVVIQNSIAEK 137 Query: 23 EREF 12 EREF Sbjct: 138 EREF 141 >ref|XP_008246558.1| PREDICTED: girdin-like [Prunus mume] Length = 1052 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/67 (37%), Positives = 44/67 (65%) Frame = -2 Query: 203 LELKEKRLNEVDSLIEERSRMIEFNEKHIESLVVLIQENSEELEVKENKFHALNASFGEK 24 ++ K L ++ LIEE+ + +E +H+ SL +LI+E++EE+ VKE +F + GEK Sbjct: 57 VQAKANELRGIERLIEEKLKEVESGTEHLRSLQLLIKEHNEEISVKEKRFSDVQRWVGEK 116 Query: 23 EREFDQL 3 E+E+D + Sbjct: 117 EKEYDSI 123