BLASTX nr result
ID: Ziziphus21_contig00031703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031703 (201 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CEH44534.1| hypothetical protein XAC3610_10050001 [Xanthomon... 72 9e-14 emb|CEH53215.1| hypothetical protein XACS582_11310001 [Xanthomon... 72 3e-13 emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum... 50 3e-10 >emb|CEH44534.1| hypothetical protein XAC3610_10050001 [Xanthomonas citri pv. citri] gi|703423244|emb|CEH63558.1| hypothetical protein XACLG97_9100001 [Xanthomonas citri pv. citri] gi|703430056|emb|CEI15539.1| hypothetical protein XACB302_8740001 [Xanthomonas citri pv. citri] gi|703437873|emb|CEI35905.1| hypothetical protein XACJJ10_1720001 [Xanthomonas citri pv. citri] gi|703445226|emb|CEH45422.1| hypothetical protein XACLD7_12360002 [Xanthomonas citri pv. citri] gi|703447424|emb|CEH54604.1| hypothetical protein XACJK48_7680001 [Xanthomonas citri pv. citri] gi|703456990|emb|CEH43546.1| hypothetical protein XAC3615_11480001 [Xanthomonas citri pv. citri] gi|703458187|emb|CEH65841.1| hypothetical protein XACG102_9020002 [Xanthomonas citri pv. citri] gi|703464589|emb|CEH54703.1| hypothetical protein XACLE3_7360001 [Xanthomonas citri pv. citri] gi|703471602|emb|CEH78138.1| hypothetical protein XAC3612_2290002 [Xanthomonas citri pv. citri] gi|713449143|emb|CEI07008.1| hypothetical protein XACG115_2260002 [Xanthomonas citri pv. citri] gi|713455677|emb|CEI16169.1| hypothetical protein XACLG98_2430001 [Xanthomonas citri pv. citri] gi|713469874|emb|CEH96247.1| hypothetical protein XACG117_2160001 [Xanthomonas citri pv. citri] gi|713475913|emb|CEH96682.1| hypothetical protein XACB100_2230001 [Xanthomonas citri pv. citri] gi|713483752|emb|CEH78239.1| hypothetical protein XACLH37_2340001 [Xanthomonas citri pv. citri] gi|713490579|emb|CEH86566.1| hypothetical protein XAC3607_3090001 [Xanthomonas citri pv. citri] gi|723790528|emb|CEJ25532.1| hypothetical protein XACE116_10060001 [Xanthomonas citri pv. citri] gi|723796379|emb|CEJ20942.1| hypothetical protein XACE116_10060001 [Xanthomonas citri pv. citri] gi|746993133|emb|CEL46621.1| hypothetical protein XAC439_9960001 [Xanthomonas citri pv. citri] gi|747001138|emb|CEL39943.1| hypothetical protein XACJK4_2420001 [Xanthomonas citri pv. citri] gi|747006769|emb|CEL48745.1| hypothetical protein XACJM35_2180001 [Xanthomonas citri pv. citri] gi|747011621|emb|CEL34943.1| hypothetical protein XAC4311_2140001 [Xanthomonas citri pv. citri] Length = 150 Score = 72.0 bits (175), Expect(2) = 9e-14 Identities = 37/51 (72%), Positives = 38/51 (74%) Frame = +2 Query: 47 TQRLKTPCSDSVSLRLPYSVKLATECKSLTHYTKGTPSPRRAPTFCMHAVS 199 T R P SDSVSLRLPY+VKLAT KSLTHYTKGT S RAPT C H VS Sbjct: 29 TARDYAPLSDSVSLRLPYTVKLATNSKSLTHYTKGTQSLLRAPTACTHTVS 79 Score = 31.2 bits (69), Expect(2) = 9e-14 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 3 TFILAMDRSPGFGSTPSD 56 TF LAM RSPGFGST D Sbjct: 15 TFTLAMTRSPGFGSTARD 32 >emb|CEH53215.1| hypothetical protein XACS582_11310001 [Xanthomonas citri pv. citri] gi|713462852|emb|CEH94261.1| hypothetical protein XACS581_1990001 [Xanthomonas citri pv. citri] Length = 150 Score = 72.0 bits (175), Expect(2) = 3e-13 Identities = 37/51 (72%), Positives = 38/51 (74%) Frame = +2 Query: 47 TQRLKTPCSDSVSLRLPYSVKLATECKSLTHYTKGTPSPRRAPTFCMHAVS 199 T R P SDSVSLRLPY+VKLAT KSLTHYTKGT S RAPT C H VS Sbjct: 29 TARDYAPLSDSVSLRLPYTVKLATNSKSLTHYTKGTQSLLRAPTACTHTVS 79 Score = 29.3 bits (64), Expect(2) = 3e-13 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +3 Query: 6 FILAMDRSPGFGSTPSD 56 F LAM RSPGFGST D Sbjct: 16 FTLAMTRSPGFGSTARD 32 >emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] gi|566555979|emb|CDK99198.1| protein of unknown function [Magnetospirillum gryphiswaldense MSR-1 v2] Length = 259 Score = 50.1 bits (118), Expect(3) = 3e-10 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +2 Query: 98 YSVKLATECKSLTHYTKGTPSP-RRAPTFCMHAVS 199 Y +KLA SLTHYTKGTPSP +RAPT C H+VS Sbjct: 59 YRLKLAAYTNSLTHYTKGTPSPFKRAPTACRHSVS 93 Score = 30.4 bits (67), Expect(3) = 3e-10 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 4 PSSWPWIDHLVSGLHPAT 57 PS+ PWIDH VSGL AT Sbjct: 28 PSTCPWIDHSVSGLMHAT 45 Score = 30.0 bits (66), Expect(3) = 3e-10 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 60 RRPVRTRFPCAYPIRLSL 113 RRP++TRF CAY RL L Sbjct: 46 RRPIQTRFRCAYTYRLKL 63