BLASTX nr result
ID: Ziziphus21_contig00031632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031632 (210 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098408.1| Glutamate receptor 2.7 [Morus notabilis] gi|... 57 5e-06 >ref|XP_010098408.1| Glutamate receptor 2.7 [Morus notabilis] gi|587886098|gb|EXB74932.1| Glutamate receptor 2.7 [Morus notabilis] Length = 965 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 3 KHRQILISFDSEASISRKIRVMFKIFDEKDPSSHTFKKTGELQD 134 KHR+I FD E S+ +KIR++ KIFDEKD SSHTF+K ELQ+ Sbjct: 877 KHRKIWTRFDPEVSLWQKIRMVSKIFDEKDLSSHTFRKNSELQN 920