BLASTX nr result
ID: Ziziphus21_contig00030271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00030271 (394 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006441378.1| hypothetical protein CICLE_v10024138mg [Citr... 108 1e-21 ref|XP_006466109.1| PREDICTED: putative pentatricopeptide repeat... 107 5e-21 ref|XP_011659251.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 ref|XP_011659250.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 gb|KGN44729.1| hypothetical protein Csa_7G374720 [Cucumis sativus] 106 8e-21 ref|XP_010100079.1| hypothetical protein L484_005753 [Morus nota... 105 1e-20 ref|XP_009354905.1| PREDICTED: putative pentatricopeptide repeat... 103 4e-20 ref|XP_009354903.1| PREDICTED: putative pentatricopeptide repeat... 103 4e-20 ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_008372326.1| PREDICTED: putative pentatricopeptide repeat... 102 1e-19 ref|XP_008451225.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_002520999.1| pentatricopeptide repeat-containing protein,... 96 1e-17 ref|XP_008235309.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_004292190.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-17 ref|XP_007050389.1| Pentatricopeptide repeat-containing protein,... 94 4e-17 ref|XP_009781797.1| PREDICTED: putative pentatricopeptide repeat... 94 5e-17 ref|XP_009781795.1| PREDICTED: putative pentatricopeptide repeat... 94 5e-17 ref|XP_009612407.1| PREDICTED: putative pentatricopeptide repeat... 93 9e-17 ref|XP_007201713.1| hypothetical protein PRUPE_ppa003905mg [Prun... 93 9e-17 emb|CDP03708.1| unnamed protein product [Coffea canephora] 90 6e-16 >ref|XP_006441378.1| hypothetical protein CICLE_v10024138mg [Citrus clementina] gi|557543640|gb|ESR54618.1| hypothetical protein CICLE_v10024138mg [Citrus clementina] Length = 565 Score = 108 bits (271), Expect = 1e-21 Identities = 51/73 (69%), Positives = 65/73 (89%), Gaps = 2/73 (2%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAE--KHVLPDASTFSIVIDLLSKDEKYRE 219 CAP++VT++TLM GFL+N+K S VVELLHKMAE ++++PD +TFSIV+DLL+KDEKYRE Sbjct: 490 CAPNVVTFNTLMHGFLQNNKTSKVVELLHKMAEPERNLVPDDTTFSIVVDLLAKDEKYRE 549 Query: 218 CLNLLPTFPAQKP 180 CLNLLPTF +KP Sbjct: 550 CLNLLPTFSVRKP 562 >ref|XP_006466109.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Citrus sinensis] Length = 607 Score = 107 bits (266), Expect = 5e-21 Identities = 50/73 (68%), Positives = 64/73 (87%), Gaps = 2/73 (2%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAE--KHVLPDASTFSIVIDLLSKDEKYRE 219 CAP++VT++TLM GFL+N+K S VVELLHKMAE ++++PD +TFSIV+DLL+KDEKY E Sbjct: 532 CAPNVVTFNTLMHGFLQNNKTSKVVELLHKMAEPERNLVPDDTTFSIVVDLLAKDEKYHE 591 Query: 218 CLNLLPTFPAQKP 180 CLNLLPTF +KP Sbjct: 592 CLNLLPTFSVRKP 604 >ref|XP_011659251.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like isoform X2 [Cucumis sativus] Length = 474 Score = 106 bits (264), Expect = 8e-21 Identities = 49/72 (68%), Positives = 61/72 (84%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C PDI+TY+TLMRGF +++KL VV+LLH+MA+K V PDA T SIV+D+LSKDEKY+ECL Sbjct: 395 CTPDIITYNTLMRGFYESNKLEEVVQLLHRMAQKDVSPDAITCSIVVDMLSKDEKYQECL 454 Query: 212 NLLPTFPAQKPV 177 +LLP FP QK V Sbjct: 455 HLLPRFPIQKGV 466 >ref|XP_011659250.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like isoform X1 [Cucumis sativus] Length = 581 Score = 106 bits (264), Expect = 8e-21 Identities = 49/72 (68%), Positives = 61/72 (84%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C PDI+TY+TLMRGF +++KL VV+LLH+MA+K V PDA T SIV+D+LSKDEKY+ECL Sbjct: 502 CTPDIITYNTLMRGFYESNKLEEVVQLLHRMAQKDVSPDAITCSIVVDMLSKDEKYQECL 561 Query: 212 NLLPTFPAQKPV 177 +LLP FP QK V Sbjct: 562 HLLPRFPIQKGV 573 >gb|KGN44729.1| hypothetical protein Csa_7G374720 [Cucumis sativus] Length = 231 Score = 106 bits (264), Expect = 8e-21 Identities = 49/72 (68%), Positives = 61/72 (84%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C PDI+TY+TLMRGF +++KL VV+LLH+MA+K V PDA T SIV+D+LSKDEKY+ECL Sbjct: 152 CTPDIITYNTLMRGFYESNKLEEVVQLLHRMAQKDVSPDAITCSIVVDMLSKDEKYQECL 211 Query: 212 NLLPTFPAQKPV 177 +LLP FP QK V Sbjct: 212 HLLPRFPIQKGV 223 >ref|XP_010100079.1| hypothetical protein L484_005753 [Morus notabilis] gi|587892744|gb|EXB81315.1| hypothetical protein L484_005753 [Morus notabilis] Length = 549 Score = 105 bits (262), Expect = 1e-20 Identities = 49/70 (70%), Positives = 62/70 (88%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C+P+ VTY+TLMR F N++L VVELLH+MA+++V PDASTFSIVIDL+SKD+KYRECL Sbjct: 467 CSPNYVTYNTLMRSFCDNNELPKVVELLHQMAKRNVQPDASTFSIVIDLVSKDKKYRECL 526 Query: 212 NLLPTFPAQK 183 +LLPTFP Q+ Sbjct: 527 DLLPTFPMQE 536 >ref|XP_009354905.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Pyrus x bretschneideri] Length = 633 Score = 103 bits (258), Expect = 4e-20 Identities = 49/68 (72%), Positives = 59/68 (86%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP+I+TY+ LMRGF +N + VVELLHKMAE+++ PDAST SIVIDLL KDEKYR+CL Sbjct: 559 CAPNIITYNILMRGFCQNDDSAKVVELLHKMAERNLSPDASTVSIVIDLLLKDEKYRKCL 618 Query: 212 NLLPTFPA 189 +LLPTFPA Sbjct: 619 DLLPTFPA 626 >ref|XP_009354903.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Pyrus x bretschneideri] gi|694328162|ref|XP_009354904.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Pyrus x bretschneideri] Length = 634 Score = 103 bits (258), Expect = 4e-20 Identities = 49/68 (72%), Positives = 59/68 (86%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP+I+TY+ LMRGF +N + VVELLHKMAE+++ PDAST SIVIDLL KDEKYR+CL Sbjct: 559 CAPNIITYNILMRGFCQNDDSAKVVELLHKMAERNLSPDASTVSIVIDLLLKDEKYRKCL 618 Query: 212 NLLPTFPA 189 +LLPTFPA Sbjct: 619 DLLPTFPA 626 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 103 bits (258), Expect = 4e-20 Identities = 50/73 (68%), Positives = 60/73 (82%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP++VT++TLMRGF +N ++ VVELL +MAEK PDAST SIV+DLLSKDEKYRE L Sbjct: 549 CAPNLVTFNTLMRGFCQNDEMQKVVELLQEMAEKDFSPDASTISIVVDLLSKDEKYREYL 608 Query: 212 NLLPTFPAQKPVG 174 +LLPTFPAQ G Sbjct: 609 HLLPTFPAQGQTG 621 >ref|XP_008372326.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Malus domestica] gi|657961464|ref|XP_008372327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Malus domestica] Length = 633 Score = 102 bits (253), Expect = 1e-19 Identities = 47/67 (70%), Positives = 58/67 (86%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP+I+TY+ LMRGF +N + VVE+LHKMAE+++ PDA T SIVIDLLSKDEKYR+CL Sbjct: 559 CAPNIITYNILMRGFCQNDDSAKVVEJLHKMAERNLSPDAITVSIVIDLLSKDEKYRKCL 618 Query: 212 NLLPTFP 192 +LLPTFP Sbjct: 619 DLLPTFP 625 >ref|XP_008451225.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis melo] Length = 569 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/73 (63%), Positives = 59/73 (80%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C P+I+TY+TLMRGF +++KL VV+LLH M +K VLPDA+T SIV+D+L KDEKY+ECL Sbjct: 497 CNPNIITYNTLMRGFYESNKLDEVVQLLHGMVKKDVLPDATTCSIVVDMLCKDEKYQECL 556 Query: 212 NLLPTFPAQKPVG 174 +LLP F QK G Sbjct: 557 DLLPRFSVQKHQG 569 >ref|XP_002520999.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539836|gb|EEF41416.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 628 Score = 95.9 bits (237), Expect = 1e-17 Identities = 44/70 (62%), Positives = 55/70 (78%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP++VT++TLMRG NS+ +VELLHKMA + + PDAST IV+D+L KDE Y ECL Sbjct: 557 CAPNVVTFNTLMRGLCLNSERPKIVELLHKMAARKLSPDASTLLIVMDILLKDENYHECL 616 Query: 212 NLLPTFPAQK 183 NLLPTFP Q+ Sbjct: 617 NLLPTFPVQE 626 >ref|XP_008235309.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Prunus mume] Length = 631 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/68 (61%), Positives = 56/68 (82%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP+++ Y+ LMRGF ++ + VVELLHKM +++ PD+ T S+VIDLLSKDEKYR+CL Sbjct: 557 CAPNVIIYNILMRGFCQSDDSAKVVELLHKMVTRNLSPDSCTISVVIDLLSKDEKYRKCL 616 Query: 212 NLLPTFPA 189 +LLPTFPA Sbjct: 617 DLLPTFPA 624 >ref|XP_004292190.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Fragaria vesca subsp. vesca] Length = 634 Score = 94.7 bits (234), Expect = 2e-17 Identities = 45/70 (64%), Positives = 56/70 (80%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP++VT++TLMRGF +N L VVELLHKM+E+++ PD ST SIVIDLLSKDE YR+CL Sbjct: 558 CAPNLVTFNTLMRGFCQNDDLEKVVELLHKMSERNLSPDISTTSIVIDLLSKDESYRKCL 617 Query: 212 NLLPTFPAQK 183 + LP F K Sbjct: 618 DWLPKFSQLK 627 >ref|XP_007050389.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590716300|ref|XP_007050390.1| RTE1 isoform 1 [Theobroma cacao] gi|590716304|ref|XP_007050391.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508702650|gb|EOX94546.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508702651|gb|EOX94547.1| RTE1 isoform 1 [Theobroma cacao] gi|508702652|gb|EOX94548.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 621 Score = 94.0 bits (232), Expect = 4e-17 Identities = 43/71 (60%), Positives = 55/71 (77%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C+P++VT++TLM GF +N++ +VELL KM EK + PDAST S V+DLLSKDE Y E L Sbjct: 550 CSPNVVTFNTLMHGFSQNNETQKMVELLQKMVEKKLSPDASTISAVVDLLSKDEAYHETL 609 Query: 212 NLLPTFPAQKP 180 LLPTFP Q+P Sbjct: 610 KLLPTFPVQEP 620 >ref|XP_009781797.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Nicotiana sylvestris] Length = 547 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/69 (60%), Positives = 54/69 (78%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C P++VT++TLMRGF N+ VV LL KMAEKH+ PD ST S+V++LLSKD+KY E L Sbjct: 465 CFPNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHISPDLSTISLVVELLSKDDKYHEYL 524 Query: 212 NLLPTFPAQ 186 NL+PTFP + Sbjct: 525 NLIPTFPTR 533 >ref|XP_009781795.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Nicotiana sylvestris] gi|698461540|ref|XP_009781796.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Nicotiana sylvestris] Length = 605 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/69 (60%), Positives = 54/69 (78%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C P++VT++TLMRGF N+ VV LL KMAEKH+ PD ST S+V++LLSKD+KY E L Sbjct: 523 CFPNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHISPDLSTISLVVELLSKDDKYHEYL 582 Query: 212 NLLPTFPAQ 186 NL+PTFP + Sbjct: 583 NLIPTFPTR 591 >ref|XP_009612407.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116958|ref|XP_009612408.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116960|ref|XP_009612409.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116962|ref|XP_009612410.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116964|ref|XP_009612411.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116966|ref|XP_009612412.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116968|ref|XP_009612413.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] Length = 599 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/69 (60%), Positives = 54/69 (78%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 C P++VT++TLMRGF N+ VV LL KMAEKH+ PD ST S+V++LLSKD+KY E L Sbjct: 527 CFPNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHLSPDLSTISLVVELLSKDDKYHEYL 586 Query: 212 NLLPTFPAQ 186 NL+PTFP + Sbjct: 587 NLIPTFPTR 595 >ref|XP_007201713.1| hypothetical protein PRUPE_ppa003905mg [Prunus persica] gi|462397113|gb|EMJ02912.1| hypothetical protein PRUPE_ppa003905mg [Prunus persica] Length = 541 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/68 (61%), Positives = 55/68 (80%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP+++ Y+ LMRGF ++ + VVELLH M +++ PD+ T SIVIDLLSKDEKYR+CL Sbjct: 467 CAPNVIIYNILMRGFCQSDDSAKVVELLHMMVARNLSPDSCTISIVIDLLSKDEKYRKCL 526 Query: 212 NLLPTFPA 189 +LLPTFPA Sbjct: 527 DLLPTFPA 534 >emb|CDP03708.1| unnamed protein product [Coffea canephora] Length = 607 Score = 90.1 bits (222), Expect = 6e-16 Identities = 40/69 (57%), Positives = 57/69 (82%) Frame = -3 Query: 392 CAPDIVTYDTLMRGFLKNSKLSNVVELLHKMAEKHVLPDASTFSIVIDLLSKDEKYRECL 213 CAP++VT++TLMRGF +++ V+ELL ++AE+ LPDAST S+VIDLLSKD+++ + L Sbjct: 538 CAPNLVTFNTLMRGFCISNEADRVIELLQRLAEREFLPDASTLSVVIDLLSKDDRHMKYL 597 Query: 212 NLLPTFPAQ 186 NL+PTFP Q Sbjct: 598 NLIPTFPIQ 606