BLASTX nr result
ID: Ziziphus21_contig00030243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00030243 (241 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009782242.1| PREDICTED: probable indole-3-acetic acid-ami... 111 2e-22 ref|XP_009622718.1| PREDICTED: probable indole-3-acetic acid-ami... 111 2e-22 ref|NP_179101.1| putative indole-3-acetic acid-amido synthetase ... 110 4e-22 ref|XP_008440335.1| PREDICTED: probable indole-3-acetic acid-ami... 110 4e-22 ref|XP_008238544.1| PREDICTED: probable indole-3-acetic acid-ami... 110 4e-22 ref|XP_002885948.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] gi|... 110 4e-22 ref|XP_011030377.1| PREDICTED: probable indole-3-acetic acid-ami... 110 5e-22 ref|XP_002300248.2| auxin-responsive GH3 family protein [Populus... 110 5e-22 ref|XP_007208307.1| hypothetical protein PRUPE_ppa003126mg [Prun... 109 7e-22 ref|XP_013608568.1| PREDICTED: probable indole-3-acetic acid-ami... 109 9e-22 ref|XP_010488935.1| PREDICTED: probable indole-3-acetic acid-ami... 109 9e-22 ref|XP_010467278.1| PREDICTED: probable indole-3-acetic acid-ami... 109 9e-22 ref|XP_010467277.1| PREDICTED: probable indole-3-acetic acid-ami... 109 9e-22 ref|XP_010517936.1| PREDICTED: probable indole-3-acetic acid-ami... 109 9e-22 ref|XP_009123229.1| PREDICTED: probable indole-3-acetic acid-ami... 109 9e-22 ref|XP_013705544.1| PREDICTED: probable indole-3-acetic acid-ami... 109 9e-22 ref|XP_013729254.1| PREDICTED: probable indole-3-acetic acid-ami... 109 9e-22 gb|KFK39993.1| hypothetical protein AALP_AA3G316200 [Arabis alpina] 109 9e-22 ref|XP_006299420.1| hypothetical protein CARUB_v10015580mg [Caps... 109 9e-22 emb|CAA42636.1| auxin-responsive GH3 product [Glycine max] 109 9e-22 >ref|XP_009782242.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Nicotiana sylvestris] Length = 599 Score = 111 bits (277), Expect = 2e-22 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYK PRCVN TPI ELLD+RV SVHFSP+AP+WTPERRR Sbjct: 542 NGTFEELMDYAISRGASINQYKAPRCVNFTPIVELLDSRVVSVHFSPAAPHWTPERRR 599 >ref|XP_009622718.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Nicotiana tomentosiformis] Length = 601 Score = 111 bits (277), Expect = 2e-22 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYK PRCVN TPI ELLD+RV SVHFSP+AP+WTPERRR Sbjct: 544 NGTFEELMDYAISRGASINQYKAPRCVNFTPIVELLDSRVVSVHFSPAAPHWTPERRR 601 >ref|NP_179101.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Arabidopsis thaliana] gi|62900130|sp|O82333.1|GH31_ARATH RecName: Full=Probable indole-3-acetic acid-amido synthetase GH3.1; AltName: Full=Auxin-responsive GH3-like protein 1; Short=AtGH3-1 gi|3650037|gb|AAC61292.1| putative auxin-regulated protein [Arabidopsis thaliana] gi|330251259|gb|AEC06353.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Arabidopsis thaliana] Length = 590 Score = 110 bits (275), Expect = 4e-22 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSPS P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPSLPHWTPERRR 589 >ref|XP_008440335.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Cucumis melo] Length = 607 Score = 110 bits (275), Expect = 4e-22 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYK PRCVN TPI ELLD+RV SVHFSPS P+WTPERRR Sbjct: 550 NGTFEELMDYAISRGASINQYKAPRCVNFTPIVELLDSRVTSVHFSPSKPHWTPERRR 607 >ref|XP_008238544.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Prunus mume] Length = 599 Score = 110 bits (275), Expect = 4e-22 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYK PRCVN +PI ELLD+RV SVHFSPSAP+WTPERRR Sbjct: 542 NGTFEELMDYAISRGASINQYKAPRCVNFSPIMELLDSRVVSVHFSPSAPHWTPERRR 599 >ref|XP_002885948.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] gi|297331788|gb|EFH62207.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] Length = 590 Score = 110 bits (275), Expect = 4e-22 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSPS P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPSLPHWTPERRR 589 >ref|XP_011030377.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Populus euphratica] Length = 596 Score = 110 bits (274), Expect = 5e-22 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ PYWTPERRR Sbjct: 539 NGTFEELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVVSKHFSPALPYWTPERRR 596 >ref|XP_002300248.2| auxin-responsive GH3 family protein [Populus trichocarpa] gi|550348559|gb|EEE85053.2| auxin-responsive GH3 family protein [Populus trichocarpa] Length = 596 Score = 110 bits (274), Expect = 5e-22 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ PYWTPERRR Sbjct: 539 NGTFEELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVVSKHFSPALPYWTPERRR 596 >ref|XP_007208307.1| hypothetical protein PRUPE_ppa003126mg [Prunus persica] gi|462403949|gb|EMJ09506.1| hypothetical protein PRUPE_ppa003126mg [Prunus persica] Length = 601 Score = 109 bits (273), Expect = 7e-22 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYK PRCVN +PI ELLD+RV SVHFSPSAP+WTPERRR Sbjct: 544 NGTFEELMDYAISRGASINQYKAPRCVNFSPIMELLDSRVFSVHFSPSAPHWTPERRR 601 >ref|XP_013608568.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Brassica oleracea var. oleracea] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >ref|XP_010488935.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Camelina sativa] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >ref|XP_010467278.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 isoform X2 [Camelina sativa] Length = 473 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 415 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 472 >ref|XP_010467277.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 isoform X1 [Camelina sativa] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >ref|XP_010517936.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Camelina sativa] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >ref|XP_009123229.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Brassica rapa] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >ref|XP_013705544.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Brassica napus] gi|674879754|emb|CDY52419.1| BnaCnng22400D [Brassica napus] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >ref|XP_013729254.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 [Brassica napus] gi|674877478|emb|CDY54470.1| BnaA09g52740D [Brassica napus] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >gb|KFK39993.1| hypothetical protein AALP_AA3G316200 [Arabis alpina] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >ref|XP_006299420.1| hypothetical protein CARUB_v10015580mg [Capsella rubella] gi|482568129|gb|EOA32318.1| hypothetical protein CARUB_v10015580mg [Capsella rubella] Length = 590 Score = 109 bits (272), Expect = 9e-22 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASINQYKVPRCVN TPI ELLD+RV S HFSP+ P+WTPERRR Sbjct: 532 NGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPALPHWTPERRR 589 >emb|CAA42636.1| auxin-responsive GH3 product [Glycine max] Length = 593 Score = 109 bits (272), Expect = 9e-22 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +3 Query: 3 NGTFEELMDYAISRGASINQYKVPRCVNSTPITELLDARVASVHFSPSAPYWTPERRR 176 NGTFEELMDYAISRGASI+QYKVPRCV TPITELLD+RV SVHFSPS P+WTPERRR Sbjct: 536 NGTFEELMDYAISRGASISQYKVPRCVTFTPITELLDSRVESVHFSPSEPHWTPERRR 593