BLASTX nr result
ID: Ziziphus21_contig00030106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00030106 (248 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209872.1| hypothetical protein PRUPE_ppa003837mg [Prun... 57 4e-06 >ref|XP_007209872.1| hypothetical protein PRUPE_ppa003837mg [Prunus persica] gi|462405607|gb|EMJ11071.1| hypothetical protein PRUPE_ppa003837mg [Prunus persica] Length = 545 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/59 (50%), Positives = 32/59 (54%) Frame = -2 Query: 178 MEPKSPSKLKLPVMGLFQYKRXXXXXXXXXXXXXXXVGAYLAFKPGTSTSVLKGSYYTV 2 MEPKSPSKLKL +MG QYK+ GAY F PG SV KG YYTV Sbjct: 1 MEPKSPSKLKLSIMGFAQYKQALRTGFMVTVIILLLFGAYFVFIPGKGHSVSKGPYYTV 59