BLASTX nr result
ID: Ziziphus21_contig00030093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00030093 (357 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006374458.1| hypothetical protein POPTR_0015s07330g [Popu... 81 3e-13 ref|XP_014508797.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 gb|KRH03503.1| hypothetical protein GLYMA_17G101700 [Glycine max] 78 3e-12 ref|XP_013612409.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 gb|KOM33290.1| hypothetical protein LR48_Vigan01g284600 [Vigna a... 78 3e-12 gb|KMZ69631.1| Ribulose-phosphate 3-epimerase [Zostera marina] 78 3e-12 sp|Q43157.1|RPE_SPIOL RecName: Full=Ribulose-phosphate 3-epimera... 78 3e-12 ref|XP_011101703.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_011087263.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_011087262.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_011047179.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_010678478.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_010523083.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_010483808.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_010443959.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_010457301.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_010258280.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_010258296.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_010258264.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 ref|XP_009339142.1| PREDICTED: ribulose-phosphate 3-epimerase, c... 78 3e-12 >ref|XP_006374458.1| hypothetical protein POPTR_0015s07330g [Populus trichocarpa] gi|550322222|gb|ERP52255.1| hypothetical protein POPTR_0015s07330g [Populus trichocarpa] Length = 223 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = +3 Query: 237 HLI*VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 H I VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 14 HFIQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 53 >ref|XP_014508797.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Vigna radiata var. radiata] Length = 280 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 75 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 110 >gb|KRH03503.1| hypothetical protein GLYMA_17G101700 [Glycine max] Length = 273 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 75 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 110 >ref|XP_013612409.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Brassica oleracea var. oleracea] gi|922568234|ref|XP_013612410.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Brassica oleracea var. oleracea] Length = 275 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 70 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 105 >gb|KOM33290.1| hypothetical protein LR48_Vigan01g284600 [Vigna angularis] Length = 280 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 75 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 110 >gb|KMZ69631.1| Ribulose-phosphate 3-epimerase [Zostera marina] Length = 279 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 74 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 109 >sp|Q43157.1|RPE_SPIOL RecName: Full=Ribulose-phosphate 3-epimerase, chloroplastic; AltName: Full=Pentose-5-phosphate 3-epimerase; Short=PPE; AltName: Full=R5P3E; Short=RPE; Flags: Precursor gi|1162980|gb|AAC41677.1| ribulose-5-phosphate 3-epimerase [Spinacia oleracea] gi|3264788|gb|AAC24708.1| ribulose-phosphate 3-epimerase [Spinacia oleracea] gi|902106556|gb|KNA03625.1| hypothetical protein SOVF_207280 [Spinacia oleracea] gi|1587969|prf||2207382A D-ribulose-5-phosphate 3-epimerase Length = 285 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 80 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 115 >ref|XP_011101703.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Sesamum indicum] Length = 282 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 77 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 112 >ref|XP_011087263.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic isoform X2 [Sesamum indicum] Length = 271 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 75 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 110 >ref|XP_011087262.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic isoform X1 [Sesamum indicum] Length = 280 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 75 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 110 >ref|XP_011047179.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Populus euphratica] Length = 286 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 81 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 116 >ref|XP_010678478.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870859323|gb|KMT10779.1| hypothetical protein BVRB_5g114350 [Beta vulgaris subsp. vulgaris] Length = 284 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 79 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 114 >ref|XP_010523083.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Tarenaya hassleriana] Length = 281 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 76 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 111 >ref|XP_010483808.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Camelina sativa] Length = 281 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 76 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 111 >ref|XP_010443959.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Camelina sativa] gi|727540645|ref|XP_010443960.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Camelina sativa] Length = 281 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 76 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 111 >ref|XP_010457301.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Camelina sativa] Length = 281 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 76 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 111 >ref|XP_010258280.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Nelumbo nucifera] Length = 284 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 79 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 114 >ref|XP_010258296.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like isoform X2 [Nelumbo nucifera] Length = 263 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 77 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 112 >ref|XP_010258264.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like isoform X1 [Nelumbo nucifera] gi|719966196|ref|XP_010258278.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like isoform X1 [Nelumbo nucifera] Length = 282 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 77 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 112 >ref|XP_009339142.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic [Pyrus x bretschneideri] Length = 284 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 249 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 356 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR Sbjct: 79 VKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR 114