BLASTX nr result
ID: Ziziphus21_contig00029718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029718 (300 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533966.1| pentatricopeptide repeat-containing protein,... 72 1e-10 gb|KCW64694.1| hypothetical protein EUGRSUZ_G022852, partial [Eu... 72 2e-10 ref|XP_012443161.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_009366382.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_006448464.1| hypothetical protein CICLE_v10017589mg [Citr... 70 6e-10 ref|XP_004509956.1| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 ref|XP_008338990.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_003547890.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 gb|KOM41682.1| hypothetical protein LR48_Vigan04g188000 [Vigna a... 68 3e-09 ref|XP_014501608.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_014501607.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_003628741.2| PPR containing plant-like protein [Medicago ... 65 2e-08 ref|XP_014509351.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 gb|KOM32107.1| hypothetical protein LR48_Vigan01g166300 [Vigna a... 64 6e-08 ref|XP_010501455.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_007156271.1| hypothetical protein PHAVU_003G272400g [Phas... 59 1e-06 ref|XP_010480462.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_010462690.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_008457507.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_006307006.1| hypothetical protein CARUB_v10008584mg [Caps... 57 5e-06 >ref|XP_002533966.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526049|gb|EEF28413.1| pentatricopeptide repeat-containing protein, putative, partial [Ricinus communis] Length = 515 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = -2 Query: 146 PHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIIT 9 PH LLEEK ISLL SCKT NHL+QIQ+ II HGL+ N Y+TPKIIT Sbjct: 61 PHRLLEEKIISLLYSCKTLNHLHQIQSHIINHGLQFNDYITPKIIT 106 >gb|KCW64694.1| hypothetical protein EUGRSUZ_G022852, partial [Eucalyptus grandis] Length = 138 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = -2 Query: 146 PHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 PH LLEE+ I+LLQSC+T LYQI AQ++ HGLE N YV PKIIT C Sbjct: 50 PHRLLEEQLIALLQSCRTKKQLYQIHAQVVCHGLERNHYVAPKIITTC 97 >ref|XP_012443161.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Gossypium raimondii] gi|823220913|ref|XP_012443162.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Gossypium raimondii] gi|763789609|gb|KJB56605.1| hypothetical protein B456_009G127200 [Gossypium raimondii] Length = 600 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = -2 Query: 149 PPHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 PPH +LEE FISL+QSCKT HL QIQ QI T G + N Y+TP+ T C Sbjct: 8 PPHWILEETFISLIQSCKTLKHLLQIQTQIFTRGFDQNRYITPRFTTAC 56 >ref|XP_009366382.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Pyrus x bretschneideri] gi|694380519|ref|XP_009366383.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Pyrus x bretschneideri] gi|694380521|ref|XP_009366384.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Pyrus x bretschneideri] gi|694380523|ref|XP_009366385.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Pyrus x bretschneideri] gi|694380526|ref|XP_009366386.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Pyrus x bretschneideri] gi|694380528|ref|XP_009366387.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Pyrus x bretschneideri] Length = 613 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = -2 Query: 149 PPHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 PPH LL EKFI+LLQSCK L+QIQ QII+HG +N Y+ PKI++ C Sbjct: 19 PPHRLLAEKFIALLQSCKAMKQLHQIQTQIISHGFSHNEYIAPKIVSAC 67 >ref|XP_006448464.1| hypothetical protein CICLE_v10017589mg [Citrus clementina] gi|557551075|gb|ESR61704.1| hypothetical protein CICLE_v10017589mg [Citrus clementina] Length = 611 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -2 Query: 146 PHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 PH L+EEK I LLQSC+T HL+QIQ Q++T GLE + Y+TP+IIT C Sbjct: 21 PHRLVEEKLIYLLQSCRTTKHLHQIQTQVVTSGLEQSDYITPRIITAC 68 >ref|XP_004509956.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 isoform X1 [Cicer arietinum] Length = 603 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = -2 Query: 149 PPHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 P ++E+KFISLL+SCK+ HL+QIQAQI+THGLE+N +V P IT C Sbjct: 12 PVQRIIEDKFISLLRSCKSCEHLHQIQAQIVTHGLEHNDFVAPSFITTC 60 >ref|XP_008338990.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Malus domestica] Length = 613 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = -2 Query: 149 PPHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 PPH LL EKFI+LLQSCK L+QIQ QII HG +N Y+ PKI++ C Sbjct: 19 PPHRLLAEKFIALLQSCKAMKXLHQIQTQIIAHGFSHNEYIAPKIVSAC 67 >ref|XP_003547890.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] gi|947058455|gb|KRH07861.1| hypothetical protein GLYMA_16G115600 [Glycine max] Length = 619 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -2 Query: 149 PPHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 P H ++E+KFISLL++C T L+QIQAQI+THGLE N YVTP IT C Sbjct: 16 PLHRVVEDKFISLLRTCGTCVRLHQIQAQIVTHGLEGNDYVTPSFITAC 64 >gb|KOM41682.1| hypothetical protein LR48_Vigan04g188000 [Vigna angularis] Length = 618 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -2 Query: 140 ILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 I++EEK ISLL+SC+T L+QIQAQI+THGL++N YVTP IT C Sbjct: 19 IVVEEKLISLLRSCETCTRLHQIQAQIVTHGLQSNDYVTPSFITAC 64 >ref|XP_014501608.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like isoform X2 [Vigna radiata var. radiata] Length = 618 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -2 Query: 140 ILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 IL+EEK ISLL+SC T L+QIQAQI+THGL++N YVTP IT C Sbjct: 19 ILVEEKLISLLRSCDTCMQLHQIQAQIVTHGLQSNDYVTPSFITAC 64 >ref|XP_014501607.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like isoform X1 [Vigna radiata var. radiata] Length = 663 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -2 Query: 140 ILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 IL+EEK ISLL+SC T L+QIQAQI+THGL++N YVTP IT C Sbjct: 64 ILVEEKLISLLRSCDTCMQLHQIQAQIVTHGLQSNDYVTPSFITAC 109 >ref|XP_003628741.2| PPR containing plant-like protein [Medicago truncatula] gi|657374501|gb|AET03217.2| PPR containing plant-like protein [Medicago truncatula] Length = 728 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -2 Query: 149 PPHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 P ++EEKFI+LL+SCK L+QIQAQI+THGLE+N +V P IT C Sbjct: 6 PVQRIVEEKFITLLRSCKNYERLHQIQAQIVTHGLEHNDFVAPNFITTC 54 >ref|XP_014509351.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vigna radiata var. radiata] Length = 618 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 137 LLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 ++EEK ISLL+SC+ L+QIQAQI+THGL+ N YVTP IT C Sbjct: 20 VVEEKLISLLRSCERCTQLHQIQAQIVTHGLQGNDYVTPSFITAC 64 >gb|KOM32107.1| hypothetical protein LR48_Vigan01g166300 [Vigna angularis] Length = 609 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 137 LLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 ++EEK ISLL+SC+ L+QIQAQI+THGL+ N YVTP IT C Sbjct: 11 VVEEKLISLLRSCERCTQLHQIQAQIVTHGLQGNDYVTPSFITAC 55 >ref|XP_010501455.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Camelina sativa] Length = 660 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -2 Query: 146 PHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 P LLEEK I L+SCKT L Q+Q+Q +THGL++N YV P+I+ C Sbjct: 71 PKRLLEEKLIFFLESCKTQKQLLQVQSQTVTHGLQHNDYVGPRIVAAC 118 >ref|XP_007156271.1| hypothetical protein PHAVU_003G272400g [Phaseolus vulgaris] gi|561029625|gb|ESW28265.1| hypothetical protein PHAVU_003G272400g [Phaseolus vulgaris] Length = 618 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -2 Query: 131 EEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 EE ISLL+SC+T L+QI AQI+ HGL+ N YVTP IT C Sbjct: 22 EETLISLLRSCQTCTRLHQIHAQIVAHGLQGNDYVTPSFITAC 64 >ref|XP_010480462.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like, partial [Camelina sativa] Length = 606 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -2 Query: 146 PHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 P LLEEK IS L+SCKT L ++Q+Q + HGL++N YV P+I+ C Sbjct: 17 PKRLLEEKLISFLESCKTQKQLLEVQSQTLIHGLQHNDYVGPRIVAAC 64 >ref|XP_010462690.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like, partial [Camelina sativa] Length = 610 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 146 PHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKII 12 P LLEEK IS L+SCKT L Q+Q Q +THGL++N YV P+I+ Sbjct: 21 PKRLLEEKLISFLESCKTQKQLLQVQLQTVTHGLQHNDYVGPRIV 65 >ref|XP_008457507.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cucumis melo] Length = 593 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 146 PHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIIT 9 P +LEE FISLL+SCKT L ++QAQIITHG ++N YV ++T Sbjct: 3 PRWVLEEHFISLLRSCKTVALLQKVQAQIITHGFQHNGYVATNVVT 48 >ref|XP_006307006.1| hypothetical protein CARUB_v10008584mg [Capsella rubella] gi|482575717|gb|EOA39904.1| hypothetical protein CARUB_v10008584mg [Capsella rubella] Length = 625 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = -2 Query: 146 PHILLEEKFISLLQSCKTANHLYQIQAQIITHGLENNAYVTPKIITVC 3 P LLEEK IS L+SCKT L QIQ+Q ++H L +N YV P+I+ C Sbjct: 36 PKRLLEEKLISFLESCKTQKQLLQIQSQTVSHELAHNDYVGPRIVAAC 83