BLASTX nr result
ID: Ziziphus21_contig00029685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029685 (202 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010100320.1| hypothetical protein L484_027628 [Morus nota... 62 1e-07 >ref|XP_010100320.1| hypothetical protein L484_027628 [Morus notabilis] gi|587893922|gb|EXB82454.1| hypothetical protein L484_027628 [Morus notabilis] Length = 1284 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/67 (47%), Positives = 41/67 (61%) Frame = +2 Query: 2 SSEEENGHDRSDTSTRTPXXXXXXXXXXXGESTANMNSPRNGSHFSDRKRDGRRNITKSV 181 SSE+E G D SDTSTRTP GES +N NSP GS+ S+R + G R+ KS Sbjct: 1177 SSEDEGGTDDSDTSTRTPSDYSQSSDYSDGESNSNFNSPERGSYASNRMKSGGRSTIKSC 1236 Query: 182 SSNLKDM 202 SS+ ++M Sbjct: 1237 SSSARNM 1243