BLASTX nr result
ID: Ziziphus21_contig00029675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029675 (388 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011017276.1| PREDICTED: 30S ribosomal protein S9, chlorop... 69 2e-09 ref|XP_011031167.1| PREDICTED: 30S ribosomal protein S9, chlorop... 69 2e-09 ref|XP_010243293.1| PREDICTED: 30S ribosomal protein S9, chlorop... 69 2e-09 ref|XP_010278487.1| PREDICTED: 30S ribosomal protein S9, chlorop... 69 2e-09 ref|XP_008466625.1| PREDICTED: 30S ribosomal protein S9, chlorop... 69 2e-09 ref|XP_002302464.1| 30S ribosomal protein S9 [Populus trichocarp... 69 2e-09 ref|XP_006375046.1| 30S ribosomal protein S9 [Populus trichocarp... 69 2e-09 ref|XP_002283650.1| PREDICTED: 30S ribosomal protein S9, chlorop... 69 2e-09 ref|XP_004147796.1| PREDICTED: 30S ribosomal protein S9, chlorop... 68 2e-09 ref|XP_014505403.1| PREDICTED: 30S ribosomal protein S9, chlorop... 68 3e-09 gb|KOM33768.1| hypothetical protein LR48_Vigan01g332400 [Vigna a... 68 3e-09 ref|XP_013645966.1| PREDICTED: 30S ribosomal protein S9, chlorop... 67 4e-09 ref|XP_013592294.1| PREDICTED: 30S ribosomal protein S9, chlorop... 67 4e-09 ref|XP_013588412.1| PREDICTED: 30S ribosomal protein S9, chlorop... 67 4e-09 ref|XP_009106154.1| PREDICTED: 30S ribosomal protein S9, chlorop... 67 4e-09 ref|XP_009104732.1| PREDICTED: 30S ribosomal protein S9, chlorop... 67 4e-09 ref|XP_013702375.1| PREDICTED: 30S ribosomal protein S9, chlorop... 67 4e-09 ref|XP_013592295.1| PREDICTED: 30S ribosomal protein S9, chlorop... 67 4e-09 ref|XP_013649939.1| PREDICTED: 30S ribosomal protein S9, chlorop... 67 4e-09 gb|KFK41937.1| hypothetical protein AALP_AA2G191300 [Arabis alpina] 67 4e-09 >ref|XP_011017276.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like [Populus euphratica] Length = 211 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK Sbjct: 117 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 147 >ref|XP_011031167.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like [Populus euphratica] Length = 210 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK Sbjct: 116 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 146 >ref|XP_010243293.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like [Nelumbo nucifera] Length = 210 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK Sbjct: 116 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 146 >ref|XP_010278487.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like [Nelumbo nucifera] Length = 210 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK Sbjct: 116 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 146 >ref|XP_008466625.1| PREDICTED: 30S ribosomal protein S9, chloroplastic [Cucumis melo] Length = 204 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK Sbjct: 110 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 140 >ref|XP_002302464.1| 30S ribosomal protein S9 [Populus trichocarpa] gi|222844190|gb|EEE81737.1| 30S ribosomal protein S9 [Populus trichocarpa] Length = 211 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK Sbjct: 117 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 147 >ref|XP_006375046.1| 30S ribosomal protein S9 [Populus trichocarpa] gi|118483304|gb|ABK93554.1| unknown [Populus trichocarpa] gi|550323360|gb|ERP52843.1| 30S ribosomal protein S9 [Populus trichocarpa] Length = 210 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK Sbjct: 116 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 146 >ref|XP_002283650.1| PREDICTED: 30S ribosomal protein S9, chloroplastic [Vitis vinifera] gi|147855629|emb|CAN79164.1| hypothetical protein VITISV_019246 [Vitis vinifera] gi|302142422|emb|CBI19625.3| unnamed protein product [Vitis vinifera] Length = 209 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK Sbjct: 115 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 145 >ref|XP_004147796.1| PREDICTED: 30S ribosomal protein S9, chloroplastic [Cucumis sativus] gi|700204795|gb|KGN59928.1| hypothetical protein Csa_3G854240 [Cucumis sativus] Length = 204 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVK+PLVTLGYESSYDVFVK Sbjct: 110 EYLQGNPLWLQYVKIPLVTLGYESSYDVFVK 140 >ref|XP_014505403.1| PREDICTED: 30S ribosomal protein S9, chloroplastic [Vigna radiata var. radiata] Length = 202 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQY+KVPL+TLGYESSYDVFVK Sbjct: 108 EYLQGNPLWLQYIKVPLITLGYESSYDVFVK 138 >gb|KOM33768.1| hypothetical protein LR48_Vigan01g332400 [Vigna angularis] Length = 202 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQY+KVPL+TLGYESSYDVFVK Sbjct: 108 EYLQGNPLWLQYIKVPLITLGYESSYDVFVK 138 >ref|XP_013645966.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like, partial [Brassica napus] Length = 164 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 70 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 100 >ref|XP_013592294.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like isoform X1 [Brassica oleracea var. oleracea] Length = 238 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 144 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 174 >ref|XP_013588412.1| PREDICTED: 30S ribosomal protein S9, chloroplastic [Brassica oleracea var. oleracea] Length = 211 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 117 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 147 >ref|XP_009106154.1| PREDICTED: 30S ribosomal protein S9, chloroplastic [Brassica rapa] Length = 211 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 117 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 147 >ref|XP_009104732.1| PREDICTED: 30S ribosomal protein S9, chloroplastic [Brassica rapa] gi|923665426|ref|XP_013648885.1| PREDICTED: 30S ribosomal protein S9, chloroplastic [Brassica napus] gi|674965910|emb|CDX68153.1| BnaA07g21930D [Brassica napus] Length = 212 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 118 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 148 >ref|XP_013702375.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like [Brassica napus] gi|674960629|emb|CDX73129.1| BnaC06g35770D [Brassica napus] Length = 211 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 117 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 147 >ref|XP_013592295.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like isoform X2 [Brassica oleracea var. oleracea] gi|923783565|ref|XP_013682528.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like [Brassica napus] gi|923783572|ref|XP_013682529.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like [Brassica napus] gi|674947507|emb|CDX85870.1| BnaC06g22640D [Brassica napus] Length = 211 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 117 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 147 >ref|XP_013649939.1| PREDICTED: 30S ribosomal protein S9, chloroplastic-like [Brassica napus] gi|674870511|emb|CDY64476.1| BnaAnng19390D [Brassica napus] Length = 212 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 118 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 148 >gb|KFK41937.1| hypothetical protein AALP_AA2G191300 [Arabis alpina] Length = 210 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EYLQGNPLWLQYVKVPLVTLGYESSYDVFVK 3 EYLQGNPLWLQYVKVPLVTLGYE+SYDVFVK Sbjct: 116 EYLQGNPLWLQYVKVPLVTLGYENSYDVFVK 146