BLASTX nr result
ID: Ziziphus21_contig00029399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029399 (340 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010090038.1| hypothetical protein L484_027269 [Morus nota... 60 8e-07 >ref|XP_010090038.1| hypothetical protein L484_027269 [Morus notabilis] gi|587848576|gb|EXB38835.1| hypothetical protein L484_027269 [Morus notabilis] Length = 608 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 113 TLPPPFAPKESLTKRYKLVWRVLLISNFALGGYLFAR 3 ++PPP PKESLT+R KL+WR LLISN ALG Y+FAR Sbjct: 7 SVPPPSPPKESLTRRNKLIWRALLISNLALGAYMFAR 43