BLASTX nr result
ID: Ziziphus21_contig00029334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029334 (397 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107484.1| Phosphoglycerate kinase 1 [Morus notabilis] ... 63 8e-08 >ref|XP_010107484.1| Phosphoglycerate kinase 1 [Morus notabilis] gi|587928991|gb|EXC16166.1| Phosphoglycerate kinase 1 [Morus notabilis] Length = 683 Score = 63.2 bits (152), Expect = 8e-08 Identities = 38/90 (42%), Positives = 48/90 (53%), Gaps = 9/90 (10%) Frame = -2 Query: 246 LLKPLQETLCFSKFSRNDCWPKFQLNKPCWLIGECAYLLKRHNIKSSLRGNWEAVNHVES 67 LL QE L SK + WP+ Q P W GE A LK H+++SS +G + VNHVES Sbjct: 6 LLSLPQEPLFLSKLKTHH-WPRLQKQPPLWFTGESAQSLKCHSVQSSSQGTLKVVNHVES 64 Query: 66 SLKHK---------DSDVFPDVQALRKFPK 4 L +K +S+ P VQ L KFPK Sbjct: 65 LLDNKAFACNEEESESNALPYVQTLGKFPK 94