BLASTX nr result
ID: Ziziphus21_contig00029296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029296 (394 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258389.1| PREDICTED: thyroid adenoma-associated protei... 65 2e-08 ref|XP_008230981.1| PREDICTED: LOW QUALITY PROTEIN: thyroid aden... 64 4e-08 ref|XP_007214847.1| hypothetical protein PRUPE_ppa000039mg [Prun... 64 4e-08 ref|XP_007032508.1| Uncharacterized protein TCM_018498 [Theobrom... 63 1e-07 ref|XP_011652865.1| PREDICTED: uncharacterized protein LOC101204... 62 2e-07 ref|XP_012483629.1| PREDICTED: thyroid adenoma-associated protei... 62 2e-07 gb|KJB33562.1| hypothetical protein B456_006G018000 [Gossypium r... 62 2e-07 gb|KGN59577.1| hypothetical protein Csa_3G827200 [Cucumis sativus] 62 2e-07 ref|XP_010693228.1| PREDICTED: thyroid adenoma-associated protei... 60 5e-07 ref|XP_008443417.1| PREDICTED: uncharacterized protein LOC103487... 60 6e-07 emb|CBI22195.3| unnamed protein product [Vitis vinifera] 60 6e-07 ref|XP_002277958.2| PREDICTED: thyroid adenoma-associated protei... 60 6e-07 emb|CAN72934.1| hypothetical protein VITISV_020616 [Vitis vinifera] 60 6e-07 ref|XP_010108975.1| hypothetical protein L484_027170 [Morus nota... 59 1e-06 ref|XP_008784315.1| PREDICTED: thyroid adenoma-associated protei... 59 2e-06 ref|XP_013450958.1| death receptor interacting protein, putative... 58 2e-06 ref|XP_009393702.1| PREDICTED: thyroid adenoma-associated protei... 58 3e-06 ref|XP_009341002.1| PREDICTED: uncharacterized protein LOC103933... 57 7e-06 ref|XP_008353419.1| PREDICTED: uncharacterized protein LOC103416... 57 7e-06 ref|XP_008348069.1| PREDICTED: uncharacterized protein LOC103411... 57 7e-06 >ref|XP_010258389.1| PREDICTED: thyroid adenoma-associated protein homolog [Nelumbo nucifera] gi|720007706|ref|XP_010258390.1| PREDICTED: thyroid adenoma-associated protein homolog [Nelumbo nucifera] Length = 2217 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGS 12 MSAKWRA+QHRHRYTY++VVFP+SYIE LNLL S + S Sbjct: 1 MSAKWRALQHRHRYTYSSVVFPHSYIESLNLLPSDISS 38 >ref|XP_008230981.1| PREDICTED: LOW QUALITY PROTEIN: thyroid adenoma-associated protein homolog [Prunus mume] Length = 2177 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGS 12 MS+KWRAIQHRHRYTYN VVFP+SY E LN L S+L S Sbjct: 1 MSSKWRAIQHRHRYTYNTVVFPSSYTESLNSLPSQLSS 38 >ref|XP_007214847.1| hypothetical protein PRUPE_ppa000039mg [Prunus persica] gi|462410997|gb|EMJ16046.1| hypothetical protein PRUPE_ppa000039mg [Prunus persica] Length = 2195 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGS 12 MS+KWRAIQHRHRYTYN VVFP+SY E LN L S+L S Sbjct: 1 MSSKWRAIQHRHRYTYNTVVFPSSYTESLNSLPSQLSS 38 >ref|XP_007032508.1| Uncharacterized protein TCM_018498 [Theobroma cacao] gi|508711537|gb|EOY03434.1| Uncharacterized protein TCM_018498 [Theobroma cacao] Length = 2221 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGSPT 6 MSAKWRAIQHRHRYTYNAVVFP S+I+ LN SPT Sbjct: 1 MSAKWRAIQHRHRYTYNAVVFPPSFIDSLNQSSLSASSPT 40 >ref|XP_011652865.1| PREDICTED: uncharacterized protein LOC101204483 [Cucumis sativus] Length = 2049 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHS 24 MSAKWRA+QHRHRYTY+A+VFPNSY++ LN S Sbjct: 1 MSAKWRALQHRHRYTYSAIVFPNSYVDSLNSFQS 34 >ref|XP_012483629.1| PREDICTED: thyroid adenoma-associated protein homolog isoform X1 [Gossypium raimondii] gi|763766350|gb|KJB33565.1| hypothetical protein B456_006G018000 [Gossypium raimondii] Length = 2220 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGSPT 6 MSAKWRAIQHRHRYTYNAVVFP S+I+ LN +PT Sbjct: 1 MSAKWRAIQHRHRYTYNAVVFPPSFIDSLNQSSLSASAPT 40 >gb|KJB33562.1| hypothetical protein B456_006G018000 [Gossypium raimondii] Length = 2175 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGSPT 6 MSAKWRAIQHRHRYTYNAVVFP S+I+ LN +PT Sbjct: 1 MSAKWRAIQHRHRYTYNAVVFPPSFIDSLNQSSLSASAPT 40 >gb|KGN59577.1| hypothetical protein Csa_3G827200 [Cucumis sativus] Length = 2038 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHS 24 MSAKWRA+QHRHRYTY+A+VFPNSY++ LN S Sbjct: 1 MSAKWRALQHRHRYTYSAIVFPNSYVDSLNSFQS 34 >ref|XP_010693228.1| PREDICTED: thyroid adenoma-associated protein homolog [Beta vulgaris subsp. vulgaris] gi|870846724|gb|KMS99220.1| hypothetical protein BVRB_2g046590 [Beta vulgaris subsp. vulgaris] Length = 2178 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLH 27 MSAKWRA+QHRHRYTY+AV+FP SYI+ L LH Sbjct: 1 MSAKWRALQHRHRYTYSAVIFPQSYIDSLTQLH 33 >ref|XP_008443417.1| PREDICTED: uncharacterized protein LOC103487009 [Cucumis melo] Length = 2196 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHS 24 MSAKWRA+QHRHRYTY+A+VFPNS+++ LN S Sbjct: 1 MSAKWRALQHRHRYTYSAIVFPNSFVDSLNSFRS 34 >emb|CBI22195.3| unnamed protein product [Vitis vinifera] Length = 1789 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLN 36 MSAKWRA+QHRHRYTY+AVVFP SY+E LN Sbjct: 1 MSAKWRALQHRHRYTYSAVVFPQSYVESLN 30 >ref|XP_002277958.2| PREDICTED: thyroid adenoma-associated protein homolog [Vitis vinifera] Length = 2223 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLN 36 MSAKWRA+QHRHRYTY+AVVFP SY+E LN Sbjct: 1 MSAKWRALQHRHRYTYSAVVFPQSYVESLN 30 >emb|CAN72934.1| hypothetical protein VITISV_020616 [Vitis vinifera] Length = 2161 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLN 36 MSAKWRA+QHRHRYTY+AVVFP SY+E LN Sbjct: 1 MSAKWRALQHRHRYTYSAVVFPQSYVESLN 30 >ref|XP_010108975.1| hypothetical protein L484_027170 [Morus notabilis] gi|587933652|gb|EXC20615.1| hypothetical protein L484_027170 [Morus notabilis] Length = 2199 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSK 21 MSAKWRAIQHRHRYTYNAVVFP+SY + + + S+ Sbjct: 1 MSAKWRAIQHRHRYTYNAVVFPDSYADSFSTISSR 35 >ref|XP_008784315.1| PREDICTED: thyroid adenoma-associated protein homolog [Phoenix dactylifera] Length = 2214 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGS 12 MSAKWRA+QHRHRYTY++VVFP ++E LNL+ S + S Sbjct: 1 MSAKWRALQHRHRYTYSSVVFPKPFVEALNLVPSNVFS 38 >ref|XP_013450958.1| death receptor interacting protein, putative [Medicago truncatula] gi|657380953|gb|KEH24998.1| death receptor interacting protein, putative [Medicago truncatula] Length = 2197 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 12/45 (26%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIE------------HLNLLH 27 MSAKWRA+QHRH+YTYNAVVFP+S++ HLNLLH Sbjct: 1 MSAKWRALQHRHKYTYNAVVFPSSFLNSLSLNPNPDSPFHLNLLH 45 >ref|XP_009393702.1| PREDICTED: thyroid adenoma-associated protein homolog [Musa acuminata subsp. malaccensis] gi|695013814|ref|XP_009393703.1| PREDICTED: thyroid adenoma-associated protein homolog [Musa acuminata subsp. malaccensis] Length = 2191 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGS 12 MSAKWRA+QHRHRYTY++VVFP ++E L L+ S++ S Sbjct: 1 MSAKWRALQHRHRYTYSSVVFPKPFVEALKLVPSEVSS 38 >ref|XP_009341002.1| PREDICTED: uncharacterized protein LOC103933073 [Pyrus x bretschneideri] gi|694426670|ref|XP_009341004.1| PREDICTED: uncharacterized protein LOC103933073 [Pyrus x bretschneideri] Length = 2217 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGS 12 MS+KWRAIQHRHRYTYN VVFP +Y + LN L ++ + Sbjct: 1 MSSKWRAIQHRHRYTYNTVVFPATYTDSLNSLPPQIAT 38 >ref|XP_008353419.1| PREDICTED: uncharacterized protein LOC103416988 [Malus domestica] Length = 2217 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGS 12 MS+KWRAIQHRHRYTYN VVFP +Y + LN L ++ + Sbjct: 1 MSSKWRAIQHRHRYTYNTVVFPATYTDSLNSLPPQIAT 38 >ref|XP_008348069.1| PREDICTED: uncharacterized protein LOC103411194 isoform X1 [Malus domestica] Length = 2217 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 125 MSAKWRAIQHRHRYTYNAVVFPNSYIEHLNLLHSKLGS 12 MS+KWRAIQHRHRYTYN VVFP +Y + LN L ++ + Sbjct: 1 MSSKWRAIQHRHRYTYNTVVFPATYTDSLNSLPPQIAT 38