BLASTX nr result
ID: Ziziphus21_contig00029244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029244 (309 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097418.1| hypothetical protein L484_009642 [Morus nota... 64 6e-08 ref|XP_010112014.1| hypothetical protein L484_004701 [Morus nota... 61 4e-07 >ref|XP_010097418.1| hypothetical protein L484_009642 [Morus notabilis] gi|587879053|gb|EXB68035.1| hypothetical protein L484_009642 [Morus notabilis] Length = 462 Score = 63.5 bits (153), Expect = 6e-08 Identities = 37/88 (42%), Positives = 48/88 (54%), Gaps = 2/88 (2%) Frame = -3 Query: 289 LELKRLLAVEYIXXXXXXXXXXXXXXXXSLKVVYLENLPNLKRWWRDA-DNQMLPSFPNC 113 LEL L +EYI SL+ ++L NL NLK WWR+ ++LP FP C Sbjct: 118 LELNSLPCLEYINGEEEDLLLSSTIILPSLRELWLSNLSNLKGWWREVVSGELLPCFPPC 177 Query: 112 LSKLVIRDCPKLHSTPL-THTEVGLVLK 32 LSKL++RDC +L PL H E L L+ Sbjct: 178 LSKLIVRDCLQLSCMPLYPHLEKRLELR 205 >ref|XP_010112014.1| hypothetical protein L484_004701 [Morus notabilis] gi|587945994|gb|EXC32359.1| hypothetical protein L484_004701 [Morus notabilis] Length = 600 Score = 60.8 bits (146), Expect = 4e-07 Identities = 37/91 (40%), Positives = 48/91 (52%), Gaps = 1/91 (1%) Frame = -3 Query: 289 LELKRLLAVEYIXXXXXXXXXXXXXXXXSLKVVYLENLPNLKRWWRDA-DNQMLPSFPNC 113 LEL L +EYI SL+ + L +LPNLK WWR+ ++LP FP C Sbjct: 292 LELNFLPCLEYINGEEEDLLLSSTIVLPSLRELRLRDLPNLKGWWREVVSGELLPCFPPC 351 Query: 112 LSKLVIRDCPKLHSTPLTHTEVGLVLKINSR 20 LS L IR+CP+L PL G + IN+R Sbjct: 352 LSTLEIRNCPQLSCMPLYPHLEGRLDLINTR 382