BLASTX nr result
ID: Ziziphus21_contig00028854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028854 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273242.2| PREDICTED: oleosin 18.2 kDa [Vitis vinifera] 68 2e-09 >ref|XP_002273242.2| PREDICTED: oleosin 18.2 kDa [Vitis vinifera] Length = 254 Score = 68.2 bits (165), Expect = 2e-09 Identities = 53/112 (47%), Positives = 61/112 (54%), Gaps = 8/112 (7%) Frame = +2 Query: 125 KSQSPQKPTSRTSQNFFP----PRVPLHVSDLSSSSTCPFVQ----LLFFNPPCSVFSLF 280 K +SP +R + N PRVPLHVS +S TC + FF P SVFS+F Sbjct: 29 KKKSPVPTRTRATTNLGVLNPLPRVPLHVS---TSHTCQPIPTPPPFCFFYNPSSVFSIF 85 Query: 281 IFPSLSLPELEVISTMADRHPSSAQTHRNPSRPNQEASTFLRRLHERAPNST 436 +LSL STMADRH S QT R P RP S FLRRLH+ APNST Sbjct: 86 ---NLSLCR----STMADRHSGSGQTQR-PPRPTP-GSAFLRRLHDHAPNST 128