BLASTX nr result
ID: Ziziphus21_contig00028805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028805 (353 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010269715.1| PREDICTED: structure-specific endonuclease s... 57 7e-06 >ref|XP_010269715.1| PREDICTED: structure-specific endonuclease subunit SLX1 [Nelumbo nucifera] Length = 170 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 290 SVLLLQHRPAALNKVKGSSDCTHLEIDWHLNP 195 S+LLLQHR AAL++VKGS DCT+LEIDW LNP Sbjct: 138 SLLLLQHRKAALDRVKGSFDCTYLEIDWQLNP 169