BLASTX nr result
ID: Ziziphus21_contig00028643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028643 (202 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207455.1| hypothetical protein PRUPE_ppa005628mg [Prun... 59 1e-06 >ref|XP_007207455.1| hypothetical protein PRUPE_ppa005628mg [Prunus persica] gi|462403097|gb|EMJ08654.1| hypothetical protein PRUPE_ppa005628mg [Prunus persica] Length = 450 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -2 Query: 99 SALLICFAWTEHFRNGYLTQSTMVWSEGRSEWQ 1 S LLI FAWTEHF NGYLT +T+VW++GRS WQ Sbjct: 6 STLLIYFAWTEHFLNGYLTHTTLVWAQGRSAWQ 38