BLASTX nr result
ID: Ziziphus21_contig00028628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028628 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491308.1| PREDICTED: uncharacterized protein LOC102630... 63 7e-08 gb|KJB41580.1| hypothetical protein B456_007G110400, partial [Go... 62 1e-07 >ref|XP_006491308.1| PREDICTED: uncharacterized protein LOC102630309 [Citrus sinensis] Length = 50 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 143 CLPLPLRQKSKVQLPGGKILKEKRARLYIIQRCVLMLICWREDRD 277 CL P R+ KVQ+ +IL+EKRARLYII+RCVLML+CWR+ D Sbjct: 5 CLGFPRRRSGKVQVSRTRILEEKRARLYIIRRCVLMLLCWRDHED 49 >gb|KJB41580.1| hypothetical protein B456_007G110400, partial [Gossypium raimondii] Length = 69 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = +2 Query: 119 KRKLVGMGCLPLPLRQKSKVQLPGGKILKEKRARLYIIQRCVLMLICWREDRD 277 + K V + +R++ KVQ P +IL +KRARLYII RCVLMLICWR+ +D Sbjct: 16 EEKAVQRKLMAFSVRKRGKVQFPRSRILNQKRARLYIIHRCVLMLICWRDPKD 68