BLASTX nr result
ID: Ziziphus21_contig00028572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028572 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN05542.1| ABC transporter E family member 2 [Glycine soja] 57 5e-06 ref|XP_007040863.1| RNAse l inhibitor protein 2 isoform 2 [Theob... 56 9e-06 >gb|KHN05542.1| ABC transporter E family member 2 [Glycine soja] Length = 684 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = +2 Query: 2 MDQEVVNLSGGELQRVALCLCLGKVVDLRCSTISFFFQFSGAKCLIVYVCAVVF 163 MDQEVVNLSGGELQRVALCLCLGK++ L +++ F C ++ +C + F Sbjct: 462 MDQEVVNLSGGELQRVALCLCLGKMLMLWPDFLNYVTWF----CCVLSMCPLTF 511 >ref|XP_007040863.1| RNAse l inhibitor protein 2 isoform 2 [Theobroma cacao] gi|508778108|gb|EOY25364.1| RNAse l inhibitor protein 2 isoform 2 [Theobroma cacao] Length = 515 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 2 MDQEVVNLSGGELQRVALCLCLGKVVDLRCSTISFFFQ 115 MDQEVVNLSGGELQRVALCLCLGKV L+ T+ ++ Sbjct: 461 MDQEVVNLSGGELQRVALCLCLGKVNILKSPTVKDIYK 498