BLASTX nr result
ID: Ziziphus21_contig00028562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028562 (228 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006486708.1| PREDICTED: uncharacterized protein LOC102620... 59 1e-06 ref|XP_006422558.1| hypothetical protein CICLE_v10029535mg [Citr... 59 1e-06 >ref|XP_006486708.1| PREDICTED: uncharacterized protein LOC102620484 isoform X2 [Citrus sinensis] Length = 123 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -2 Query: 200 GFILMEYAKKNVE--SLCPGLANSAAFMDCYNLLKFGGEDILSIKELKTCIGYDSKKRCA 27 GFILME+ K+ V+ SL PG A AF+ NLLK +DIL+++ELKTC+ DSK+ C+ Sbjct: 64 GFILMEHLKEKVKDLSLFPGSAEPLAFVAGCNLLKCDNDDILTVEELKTCLHIDSKRGCS 123 >ref|XP_006422558.1| hypothetical protein CICLE_v10029535mg [Citrus clementina] gi|567859812|ref|XP_006422560.1| hypothetical protein CICLE_v10029535mg [Citrus clementina] gi|557524492|gb|ESR35798.1| hypothetical protein CICLE_v10029535mg [Citrus clementina] gi|557524494|gb|ESR35800.1| hypothetical protein CICLE_v10029535mg [Citrus clementina] Length = 123 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -2 Query: 200 GFILMEYAKKNVE--SLCPGLANSAAFMDCYNLLKFGGEDILSIKELKTCIGYDSKKRCA 27 GFILME+ K+ V+ SL PG A AF+ NLLK +DIL+++ELKTC+ DSK+ C+ Sbjct: 64 GFILMEHLKEKVKDLSLFPGSAEPLAFVAGCNLLKCDNDDILTVEELKTCLHIDSKRGCS 123