BLASTX nr result
ID: Ziziphus21_contig00028491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028491 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097434.1| hypothetical protein L484_003205 [Morus nota... 60 2e-08 >ref|XP_010097434.1| hypothetical protein L484_003205 [Morus notabilis] gi|587879186|gb|EXB68164.1| hypothetical protein L484_003205 [Morus notabilis] Length = 785 Score = 60.5 bits (145), Expect(2) = 2e-08 Identities = 30/48 (62%), Positives = 37/48 (77%), Gaps = 4/48 (8%) Frame = +3 Query: 99 QFLTTTILV----VLKYAERSMALYLASLDCFGSTTLPQPNPGNDYEE 230 + LT T+LV ++KYAER+ ALYLASLD FG+T LP+P PG DYEE Sbjct: 152 KLLTPTVLVFLVGIVKYAERTRALYLASLDRFGATALPKPEPGPDYEE 199 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +2 Query: 2 LHLGGHDSITTYSL 43 +HLGG DSIT+++L Sbjct: 107 VHLGGPDSITSFAL 120