BLASTX nr result
ID: Ziziphus21_contig00028266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028266 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006404849.1| hypothetical protein EUTSA_v10000533mg, part... 60 5e-07 ref|XP_010026413.1| PREDICTED: salicylic acid-binding protein 2-... 59 1e-06 ref|XP_006436460.1| hypothetical protein CICLE_v10032396mg [Citr... 59 1e-06 ref|XP_010472355.1| PREDICTED: methylesterase 2-like [Camelina s... 59 1e-06 ref|XP_010429311.1| PREDICTED: methylesterase 2-like [Camelina s... 59 1e-06 ref|XP_010417104.1| PREDICTED: methylesterase 2 [Camelina sativa] 59 1e-06 ref|XP_006436459.1| hypothetical protein CICLE_v10032394mg [Citr... 59 1e-06 ref|XP_006294757.1| hypothetical protein CARUB_v10023802mg, part... 59 1e-06 ref|NP_179941.1| methylesterase 2 [Arabidopsis thaliana] gi|7531... 59 1e-06 gb|AAM63650.1| putative acetone-cyanohydrin lyase [Arabidopsis t... 59 1e-06 ref|XP_010472356.1| PREDICTED: methylesterase 1-like [Camelina s... 59 2e-06 ref|XP_010429312.1| PREDICTED: methylesterase 1-like [Camelina s... 59 2e-06 emb|CDY38958.1| BnaA04g13790D [Brassica napus] 59 2e-06 ref|XP_006485625.1| PREDICTED: methylesterase 1-like [Citrus sin... 59 2e-06 ref|XP_006294809.1| hypothetical protein CARUB_v10023861mg [Caps... 59 2e-06 gb|KHF99571.1| Pheophorbidase [Gossypium arboreum] 58 2e-06 ref|XP_009140475.1| PREDICTED: methylesterase 1 [Brassica rapa] ... 58 2e-06 gb|KFK32714.1| hypothetical protein AALP_AA6G279000 [Arabis alpina] 58 2e-06 gb|KDO48824.1| hypothetical protein CISIN_1g024134mg [Citrus sin... 58 2e-06 ref|XP_006436236.1| hypothetical protein CICLE_v10032328mg [Citr... 58 2e-06 >ref|XP_006404849.1| hypothetical protein EUTSA_v10000533mg, partial [Eutrema salsugineum] gi|557105977|gb|ESQ46302.1| hypothetical protein EUTSA_v10000533mg, partial [Eutrema salsugineum] Length = 276 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +3 Query: 261 KLREN*VKMAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 K+RE KM+E +K+HFVLVHGA HGAWCWYK++ L+E Sbjct: 7 KVREK--KMSEENKKQHFVLVHGACHGAWCWYKVKPLLE 43 >ref|XP_010026413.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus grandis] gi|629093304|gb|KCW59299.1| hypothetical protein EUGRSUZ_H01980 [Eucalyptus grandis] Length = 265 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +3 Query: 291 ETQRKKHFVLVHGASHGAWCWYKIRSLMET 380 ET+R+KHFVLVHGA HGAWCWYK+ +L+E+ Sbjct: 5 ETEREKHFVLVHGACHGAWCWYKVATLLES 34 >ref|XP_006436460.1| hypothetical protein CICLE_v10032396mg [Citrus clementina] gi|568864482|ref|XP_006485626.1| PREDICTED: methylesterase 1-like [Citrus sinensis] gi|557538656|gb|ESR49700.1| hypothetical protein CICLE_v10032396mg [Citrus clementina] Length = 272 Score = 59.3 bits (142), Expect = 1e-06 Identities = 21/32 (65%), Positives = 30/32 (93%) Frame = +3 Query: 282 KMAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 KMAE +++KHFVLVHG++HGAWCWYK+++ +E Sbjct: 9 KMAEAKKQKHFVLVHGSNHGAWCWYKVKAQLE 40 >ref|XP_010472355.1| PREDICTED: methylesterase 2-like [Camelina sativa] Length = 263 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHGA HGAWCWYK++ L+E Sbjct: 1 MSEEKRKQHFVLVHGACHGAWCWYKVKPLLE 31 >ref|XP_010429311.1| PREDICTED: methylesterase 2-like [Camelina sativa] Length = 264 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHGA HGAWCWYK++ L+E Sbjct: 1 MSEEKRKQHFVLVHGACHGAWCWYKVKPLLE 31 >ref|XP_010417104.1| PREDICTED: methylesterase 2 [Camelina sativa] Length = 263 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHGA HGAWCWYK++ L+E Sbjct: 1 MSEEKRKQHFVLVHGACHGAWCWYKVKPLLE 31 >ref|XP_006436459.1| hypothetical protein CICLE_v10032394mg [Citrus clementina] gi|568864484|ref|XP_006485627.1| PREDICTED: methylesterase 1-like [Citrus sinensis] gi|557538655|gb|ESR49699.1| hypothetical protein CICLE_v10032394mg [Citrus clementina] Length = 272 Score = 58.9 bits (141), Expect = 1e-06 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = +3 Query: 282 KMAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 KMAE +++KHFVLVHG++HGAWCWYK++ +E Sbjct: 9 KMAEAKKRKHFVLVHGSNHGAWCWYKVKPQLE 40 >ref|XP_006294757.1| hypothetical protein CARUB_v10023802mg, partial [Capsella rubella] gi|482563465|gb|EOA27655.1| hypothetical protein CARUB_v10023802mg, partial [Capsella rubella] Length = 282 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +3 Query: 282 KMAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 KM+E +RK+HFVLVHGA HGAWCWYK++ +E Sbjct: 19 KMSEEKRKQHFVLVHGAGHGAWCWYKVKPQLE 50 >ref|NP_179941.1| methylesterase 2 [Arabidopsis thaliana] gi|75318648|sp|O80476.1|MES2_ARATH RecName: Full=Methylesterase 2; Short=AtMES2; AltName: Full=Protein METHYLESTERASE 8; Short=AtME8 gi|13605603|gb|AAK32795.1|AF361627_1 At2g23600/F26B6.25 [Arabidopsis thaliana] gi|3242721|gb|AAC23773.1| putative acetone-cyanohydrin lyase [Arabidopsis thaliana] gi|15810085|gb|AAL06968.1| At2g23600/F26B6.25 [Arabidopsis thaliana] gi|110741147|dbj|BAE98666.1| putative acetone-cyanohydrin lyase [Arabidopsis thaliana] gi|330252377|gb|AEC07471.1| methylesterase 2 [Arabidopsis thaliana] Length = 263 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHGA HGAWCWYK++ L+E Sbjct: 1 MSEEKRKQHFVLVHGACHGAWCWYKVKPLLE 31 >gb|AAM63650.1| putative acetone-cyanohydrin lyase [Arabidopsis thaliana] Length = 263 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHGA HGAWCWYK++ L+E Sbjct: 1 MSEEKRKQHFVLVHGACHGAWCWYKVKPLLE 31 >ref|XP_010472356.1| PREDICTED: methylesterase 1-like [Camelina sativa] Length = 258 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHGA HGAWCWYK++ L+E Sbjct: 1 MSEGKRKQHFVLVHGACHGAWCWYKVKPLLE 31 >ref|XP_010429312.1| PREDICTED: methylesterase 1-like [Camelina sativa] Length = 263 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHGA HGAWCWYK++ L+E Sbjct: 1 MSEGKRKQHFVLVHGACHGAWCWYKVKPLLE 31 >emb|CDY38958.1| BnaA04g13790D [Brassica napus] Length = 302 Score = 58.5 bits (140), Expect = 2e-06 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = +3 Query: 282 KMAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 +M+E +RK+HFVLVHG+ HGAWCWYK++ L+E Sbjct: 40 EMSENKRKQHFVLVHGSCHGAWCWYKVKPLLE 71 >ref|XP_006485625.1| PREDICTED: methylesterase 1-like [Citrus sinensis] Length = 272 Score = 58.5 bits (140), Expect = 2e-06 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = +3 Query: 282 KMAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 KMAE +++KHFVLVHG++HGAWCWYK++ +E Sbjct: 9 KMAEAKKQKHFVLVHGSNHGAWCWYKVKPRLE 40 >ref|XP_006294809.1| hypothetical protein CARUB_v10023861mg [Capsella rubella] gi|482563517|gb|EOA27707.1| hypothetical protein CARUB_v10023861mg [Capsella rubella] Length = 263 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHGA HGAWCWYK++ L+E Sbjct: 1 MSEEKRKQHFVLVHGACHGAWCWYKVKVLLE 31 >gb|KHF99571.1| Pheophorbidase [Gossypium arboreum] Length = 262 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+ET K HFV+VHG HGAWCWYKIRSL+E Sbjct: 1 MSETTEKLHFVMVHGFGHGAWCWYKIRSLLE 31 >ref|XP_009140475.1| PREDICTED: methylesterase 1 [Brassica rapa] gi|923609180|ref|XP_013743670.1| PREDICTED: methylesterase 1-like [Brassica napus] Length = 262 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHG+ HGAWCWYK++ L+E Sbjct: 1 MSENKRKQHFVLVHGSCHGAWCWYKVKPLLE 31 >gb|KFK32714.1| hypothetical protein AALP_AA6G279000 [Arabis alpina] Length = 263 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = +3 Query: 285 MAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 M+E +RK+HFVLVHG+ HGAWCWYK++ L+E Sbjct: 1 MSENKRKQHFVLVHGSCHGAWCWYKVKPLLE 31 >gb|KDO48824.1| hypothetical protein CISIN_1g024134mg [Citrus sinensis] Length = 272 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = +3 Query: 261 KLREN*VKMAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 +L E KM E +++KHFVLVHG++HGAWCWYK++ +E Sbjct: 2 ELTEKVKKMTEAKKQKHFVLVHGSNHGAWCWYKVKPRLE 40 >ref|XP_006436236.1| hypothetical protein CICLE_v10032328mg [Citrus clementina] gi|568865086|ref|XP_006485914.1| PREDICTED: methylesterase 1-like [Citrus sinensis] gi|557538432|gb|ESR49476.1| hypothetical protein CICLE_v10032328mg [Citrus clementina] Length = 283 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = +3 Query: 282 KMAETQRKKHFVLVHGASHGAWCWYKIRSLME 377 +MAE +++KHFVLVHG SHGAWCWYK++ +E Sbjct: 20 RMAEAKKQKHFVLVHGTSHGAWCWYKVKPQLE 51