BLASTX nr result
ID: Ziziphus21_contig00028231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028231 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516908.1| hypothetical protein GlmaxMp59 (mitochondrio... 58 1e-14 ref|XP_013442839.1| hypothetical protein MTR_0082s0250 [Medicago... 81 3e-13 >ref|YP_007516908.1| hypothetical protein GlmaxMp59 (mitochondrion) [Glycine max] gi|403311617|gb|AFR34365.1| hypothetical protein GlmaxMp59 (mitochondrion) [Glycine max] Length = 107 Score = 57.8 bits (138), Expect(2) = 1e-14 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +2 Query: 77 LLSSYSFSLPCGGLSGVYGGSDQSRDEE-KDFPI 175 LLSSYSFSLPCGGLSGVYGGSDQSR+E D P+ Sbjct: 34 LLSSYSFSLPCGGLSGVYGGSDQSREEVFSDLPL 67 Score = 48.5 bits (114), Expect(2) = 1e-14 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 172 DLPLRKVSSRQQNLPGKLHYSGAPHGLVKGGG 267 DLPLRKVSSRQ NLPGKL GAPHGLV G G Sbjct: 64 DLPLRKVSSRQLNLPGKL--VGAPHGLVIGRG 93 >ref|XP_013442839.1| hypothetical protein MTR_0082s0250 [Medicago truncatula] gi|657370803|gb|KEH16864.1| hypothetical protein MTR_0082s0250 [Medicago truncatula] Length = 96 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 59 ESITLCLLSSYSFSLPCGGLSGVYGGSDQSRDEEKDFPIFH 181 ES+T CLLSS SFSLPCGGLSGVYGGSDQSRDEEK FPIFH Sbjct: 56 ESVTACLLSSNSFSLPCGGLSGVYGGSDQSRDEEKSFPIFH 96