BLASTX nr result
ID: Ziziphus21_contig00028063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00028063 (714 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008234746.1| PREDICTED: phosphatidylinositol 4-kinase gam... 59 4e-06 >ref|XP_008234746.1| PREDICTED: phosphatidylinositol 4-kinase gamma 3 [Prunus mume] Length = 579 Score = 58.5 bits (140), Expect = 4e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 102 MSIASVALSPGYEESLDFPGNFTSQYGPPNGDSI 1 MSIASVALSP YEESL+FP NFTSQYGP +GDSI Sbjct: 1 MSIASVALSPVYEESLNFPCNFTSQYGPFSGDSI 34