BLASTX nr result
ID: Ziziphus21_contig00027445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027445 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010089419.1| Pre-mRNA cleavage complex 2 protein Pcf11 [M... 59 1e-06 >ref|XP_010089419.1| Pre-mRNA cleavage complex 2 protein Pcf11 [Morus notabilis] gi|587847393|gb|EXB37772.1| Pre-mRNA cleavage complex 2 protein Pcf11 [Morus notabilis] Length = 1101 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/42 (66%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -1 Query: 124 MKAKGLSNDISGPMANSVEDAERLDR-TSIGTGRSWVDSSIK 2 ++AK LS+D+SG +ANS+EDAE ++R TSIGTGRSWVD S+K Sbjct: 270 LEAKELSSDVSGSIANSIEDAESMERATSIGTGRSWVDPSVK 311