BLASTX nr result
ID: Ziziphus21_contig00027441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027441 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007210651.1| hypothetical protein PRUPE_ppa019423mg, part... 170 3e-40 ref|XP_008239957.1| PREDICTED: pentatricopeptide repeat-containi... 169 6e-40 ref|XP_010663367.1| PREDICTED: pentatricopeptide repeat-containi... 163 4e-38 ref|XP_002268980.1| PREDICTED: pentatricopeptide repeat-containi... 163 4e-38 ref|XP_011649738.1| PREDICTED: pentatricopeptide repeat-containi... 161 2e-37 ref|XP_009798881.1| PREDICTED: pentatricopeptide repeat-containi... 160 3e-37 ref|XP_009616910.1| PREDICTED: pentatricopeptide repeat-containi... 160 4e-37 ref|XP_008441907.1| PREDICTED: pentatricopeptide repeat-containi... 160 4e-37 ref|XP_012438751.1| PREDICTED: pentatricopeptide repeat-containi... 159 8e-37 gb|KJB50910.1| hypothetical protein B456_008G192700, partial [Go... 159 8e-37 ref|XP_014497198.1| PREDICTED: pentatricopeptide repeat-containi... 159 1e-36 ref|XP_004492291.2| PREDICTED: pentatricopeptide repeat-containi... 158 2e-36 gb|KMT10840.1| hypothetical protein BVRB_5g114930 [Beta vulgaris... 157 2e-36 ref|XP_010678537.1| PREDICTED: pentatricopeptide repeat-containi... 157 2e-36 ref|XP_012080263.1| PREDICTED: pentatricopeptide repeat-containi... 156 5e-36 ref|XP_013448510.1| pentatricopeptide (PPR) repeat protein [Medi... 156 5e-36 gb|KDP31245.1| hypothetical protein JCGZ_11621 [Jatropha curcas] 156 5e-36 gb|KOM37781.1| hypothetical protein LR48_Vigan03g116300 [Vigna a... 156 6e-36 emb|CDP12312.1| unnamed protein product [Coffea canephora] 156 6e-36 ref|XP_007037324.1| Pentatricopeptide repeat-containing protein,... 155 1e-35 >ref|XP_007210651.1| hypothetical protein PRUPE_ppa019423mg, partial [Prunus persica] gi|462406386|gb|EMJ11850.1| hypothetical protein PRUPE_ppa019423mg, partial [Prunus persica] Length = 518 Score = 170 bits (431), Expect = 3e-40 Identities = 82/101 (81%), Positives = 90/101 (89%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+GRLKEA FI +MPIEPD+L+WGTLLAACKVHGD+ELGK AAEKVM L+P D Sbjct: 418 MVDLLGRSGRLKEAALFIENMPIEPDALLWGTLLAACKVHGDMELGKLAAEKVMELKPCD 477 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 AG YIS+SNICADVGQWEEVLKIRSQMKG V KEPGWS + Sbjct: 478 AGTYISLSNICADVGQWEEVLKIRSQMKGTDVRKEPGWSLV 518 >ref|XP_008239957.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Prunus mume] Length = 885 Score = 169 bits (429), Expect = 6e-40 Identities = 81/101 (80%), Positives = 90/101 (89%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+GRLKEA FI +MPIEPD+L+WGTLLAACKVHGD+ELGK AAEKVM L+P D Sbjct: 785 MVDLLGRSGRLKEAAWFIENMPIEPDALLWGTLLAACKVHGDMELGKLAAEKVMELKPCD 844 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 AG Y+S+SNICADVGQWEEVLKIRSQMKG V KEPGWS + Sbjct: 845 AGTYVSLSNICADVGQWEEVLKIRSQMKGTDVRKEPGWSLV 885 >ref|XP_010663367.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic isoform X2 [Vitis vinifera] Length = 861 Score = 163 bits (413), Expect = 4e-38 Identities = 75/99 (75%), Positives = 91/99 (91%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+GRLKEAERFIN+MPIEPD+L+WG LLAACKVHGDIELG+ AA++V+ LEP + Sbjct: 761 MVDLLGRSGRLKEAERFINNMPIEPDALLWGILLAACKVHGDIELGRLAAKRVIELEPCE 820 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWS 26 AGAY+++SNICAD+G WE+V+KIRS M+G GV KEPGWS Sbjct: 821 AGAYVTLSNICADMGWWEDVMKIRSLMEGTGVKKEPGWS 859 >ref|XP_002268980.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic isoform X1 [Vitis vinifera] gi|731425761|ref|XP_010663366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic isoform X1 [Vitis vinifera] gi|297733984|emb|CBI15231.3| unnamed protein product [Vitis vinifera] Length = 893 Score = 163 bits (413), Expect = 4e-38 Identities = 75/99 (75%), Positives = 91/99 (91%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+GRLKEAERFIN+MPIEPD+L+WG LLAACKVHGDIELG+ AA++V+ LEP + Sbjct: 793 MVDLLGRSGRLKEAERFINNMPIEPDALLWGILLAACKVHGDIELGRLAAKRVIELEPCE 852 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWS 26 AGAY+++SNICAD+G WE+V+KIRS M+G GV KEPGWS Sbjct: 853 AGAYVTLSNICADMGWWEDVMKIRSLMEGTGVKKEPGWS 891 >ref|XP_011649738.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic isoform X1 [Cucumis sativus] Length = 795 Score = 161 bits (408), Expect = 2e-37 Identities = 76/101 (75%), Positives = 85/101 (84%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR G+LKEAE IN MPIEPD+L+WGTLLAACKVHGDIELGK AA KVM L P D Sbjct: 695 MVDLLGRCGKLKEAEELINHMPIEPDALIWGTLLAACKVHGDIELGKLAARKVMELNPGD 754 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAY+S+SNICAD+G WEEVL +RS MK +G+ KE GWSFL Sbjct: 755 TGAYVSLSNICADMGLWEEVLNVRSLMKEVGMTKESGWSFL 795 >ref|XP_009798881.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana sylvestris] gi|698507063|ref|XP_009798882.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana sylvestris] gi|698507065|ref|XP_009798883.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana sylvestris] gi|698507067|ref|XP_009798884.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana sylvestris] gi|698507069|ref|XP_009798886.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana sylvestris] gi|698507072|ref|XP_009798887.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana sylvestris] Length = 884 Score = 160 bits (405), Expect = 3e-37 Identities = 75/101 (74%), Positives = 88/101 (87%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+GRL EAERFI++MP++PD+LVWGTLLAACKVHGD+ELGK AA K++ LEP + Sbjct: 784 MVDLLGRSGRLTEAERFISEMPMKPDALVWGTLLAACKVHGDVELGKLAANKIIELEPSE 843 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAYIS+SNI A VGQWEEVLKIR M+G G+ KEPGWS L Sbjct: 844 VGAYISLSNIWASVGQWEEVLKIRGSMQGTGIAKEPGWSSL 884 >ref|XP_009616910.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana tomentosiformis] gi|697125775|ref|XP_009616911.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana tomentosiformis] Length = 884 Score = 160 bits (404), Expect = 4e-37 Identities = 75/101 (74%), Positives = 89/101 (88%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+GRL EAER I++MP++PD+LVWGTLLAACKVHGD+ELGK AA+K++ LEP + Sbjct: 784 MVDLLGRSGRLTEAERIISEMPMKPDALVWGTLLAACKVHGDVELGKLAAKKIIELEPSE 843 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAYIS+SNI A VGQWEEVLKIRS M+G G+ KEPGWS L Sbjct: 844 VGAYISLSNIWASVGQWEEVLKIRSSMQGTGIAKEPGWSSL 884 >ref|XP_008441907.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Cucumis melo] Length = 891 Score = 160 bits (404), Expect = 4e-37 Identities = 76/101 (75%), Positives = 84/101 (83%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 +VDLLGR G+LKEAE IN MPIEPD+L+WGTLLAACKVHGDIELGK AA KVM L P D Sbjct: 791 LVDLLGRCGKLKEAEELINHMPIEPDALIWGTLLAACKVHGDIELGKLAARKVMELNPGD 850 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAY+S+SNICAD+G WEEVL +RS MK GV KE GWSFL Sbjct: 851 TGAYVSLSNICADMGLWEEVLNVRSLMKEAGVTKESGWSFL 891 >ref|XP_012438751.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Gossypium raimondii] Length = 895 Score = 159 bits (402), Expect = 8e-37 Identities = 72/99 (72%), Positives = 88/99 (88%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVD+LGR+G+LKEAE+FIN+MPIEPD+ +WGTLLAACKVHGD+ELG+ AA+KV+ LEP Sbjct: 795 MVDILGRSGKLKEAEKFINNMPIEPDAFIWGTLLAACKVHGDVELGRLAAKKVIELEPSA 854 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWS 26 AGAY+S+SNICAD+GQWE L+IRS M+G G KEPGWS Sbjct: 855 AGAYVSLSNICADMGQWEGALEIRSLMEGSGARKEPGWS 893 >gb|KJB50910.1| hypothetical protein B456_008G192700, partial [Gossypium raimondii] Length = 911 Score = 159 bits (402), Expect = 8e-37 Identities = 72/99 (72%), Positives = 88/99 (88%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVD+LGR+G+LKEAE+FIN+MPIEPD+ +WGTLLAACKVHGD+ELG+ AA+KV+ LEP Sbjct: 811 MVDILGRSGKLKEAEKFINNMPIEPDAFIWGTLLAACKVHGDVELGRLAAKKVIELEPSA 870 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWS 26 AGAY+S+SNICAD+GQWE L+IRS M+G G KEPGWS Sbjct: 871 AGAYVSLSNICADMGQWEGALEIRSLMEGSGARKEPGWS 909 >ref|XP_014497198.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Vigna radiata var. radiata] gi|950958134|ref|XP_014497199.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Vigna radiata var. radiata] Length = 924 Score = 159 bits (401), Expect = 1e-36 Identities = 73/101 (72%), Positives = 86/101 (85%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 +VDLLGR+GRL+EAE FIN M +EPD+L+WGTLLAACKVHGD ELGK AA+K++ L P D Sbjct: 824 LVDLLGRSGRLREAESFINKMLVEPDALIWGTLLAACKVHGDFELGKLAAKKILELGPSD 883 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 AG Y+S SNICADVGQWEEV KIR+ +KG G+ KEPGWS L Sbjct: 884 AGVYVSFSNICADVGQWEEVTKIRNSLKGKGMKKEPGWSLL 924 >ref|XP_004492291.2| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Cicer arietinum] Length = 916 Score = 158 bits (399), Expect = 2e-36 Identities = 73/101 (72%), Positives = 85/101 (84%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 +VDLL R+GRL+EAE FIN+MP+EPD+L+WGTLLAACKVHGD ELGK AA+KVM LEP D Sbjct: 816 IVDLLSRSGRLREAESFINNMPVEPDALIWGTLLAACKVHGDFELGKLAAKKVMELEPSD 875 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAY+S SNICAD GQWEEV KIRS + G+ KEPGWS + Sbjct: 876 VGAYVSFSNICADGGQWEEVTKIRSSLNKTGMKKEPGWSLV 916 >gb|KMT10840.1| hypothetical protein BVRB_5g114930 [Beta vulgaris subsp. vulgaris] Length = 788 Score = 157 bits (398), Expect = 2e-36 Identities = 73/101 (72%), Positives = 88/101 (87%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+GRLKEAE FIN+MPI+PD+LVWGTLLAACKVHG++ELG+ AA+KV+ L P D Sbjct: 688 MVDLLGRSGRLKEAENFINNMPIKPDALVWGTLLAACKVHGNVELGRLAAQKVIDLLPSD 747 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAYIS+SN+CAD+GQWEEV +IR MKG + KEPGWS + Sbjct: 748 PGAYISLSNLCADIGQWEEVEEIRDLMKGTTLSKEPGWSLV 788 >ref|XP_010678537.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Beta vulgaris subsp. vulgaris] Length = 896 Score = 157 bits (398), Expect = 2e-36 Identities = 73/101 (72%), Positives = 88/101 (87%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+GRLKEAE FIN+MPI+PD+LVWGTLLAACKVHG++ELG+ AA+KV+ L P D Sbjct: 796 MVDLLGRSGRLKEAENFINNMPIKPDALVWGTLLAACKVHGNVELGRLAAQKVIDLLPSD 855 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAYIS+SN+CAD+GQWEEV +IR MKG + KEPGWS + Sbjct: 856 PGAYISLSNLCADIGQWEEVEEIRDLMKGTTLSKEPGWSLV 896 >ref|XP_012080263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Jatropha curcas] Length = 904 Score = 156 bits (395), Expect = 5e-36 Identities = 73/101 (72%), Positives = 86/101 (85%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+G+LKEAE+FI MPI+PD LVW TLLAACK+HGD+ELGK AA++VM L P D Sbjct: 795 MVDLLGRSGQLKEAEKFIRSMPIDPDVLVWATLLAACKIHGDVELGKIAAKRVMELNPND 854 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAY+S+SNICAD GQWEEVL+IR+ MKG GV KE WSF+ Sbjct: 855 DGAYVSLSNICADRGQWEEVLQIRNLMKGTGVRKEAAWSFM 895 >ref|XP_013448510.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657377684|gb|KEH22537.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 881 Score = 156 bits (395), Expect = 5e-36 Identities = 72/99 (72%), Positives = 84/99 (84%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 +VD+LGR+GRL+EAE FIN+MP+EP++L+WGTLLAACKVHGD ELGK AAEKVMGLEP D Sbjct: 781 IVDILGRSGRLREAESFINNMPVEPNALIWGTLLAACKVHGDFELGKLAAEKVMGLEPSD 840 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWS 26 GAY+S SNICAD QWEEV KIRS + G+ KEP WS Sbjct: 841 VGAYVSFSNICADGEQWEEVTKIRSSLNKTGMKKEPAWS 879 >gb|KDP31245.1| hypothetical protein JCGZ_11621 [Jatropha curcas] Length = 763 Score = 156 bits (395), Expect = 5e-36 Identities = 73/101 (72%), Positives = 86/101 (85%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGR+G+LKEAE+FI MPI+PD LVW TLLAACK+HGD+ELGK AA++VM L P D Sbjct: 654 MVDLLGRSGQLKEAEKFIRSMPIDPDVLVWATLLAACKIHGDVELGKIAAKRVMELNPND 713 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 GAY+S+SNICAD GQWEEVL+IR+ MKG GV KE WSF+ Sbjct: 714 DGAYVSLSNICADRGQWEEVLQIRNLMKGTGVRKEAAWSFM 754 >gb|KOM37781.1| hypothetical protein LR48_Vigan03g116300 [Vigna angularis] Length = 903 Score = 156 bits (394), Expect = 6e-36 Identities = 71/101 (70%), Positives = 85/101 (84%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 ++DLLGR+GRL+EAE FIN M +EPD+L+WG LLAACKVHGD ELGK AA+K++ L P D Sbjct: 803 LIDLLGRSGRLREAESFINKMLVEPDALIWGILLAACKVHGDFELGKLAAKKILELGPSD 862 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 AG Y+S SNICADVGQWEEV KIR+ +KG G+ KEPGWS L Sbjct: 863 AGVYVSFSNICADVGQWEEVTKIRNSLKGKGMKKEPGWSLL 903 >emb|CDP12312.1| unnamed protein product [Coffea canephora] Length = 893 Score = 156 bits (394), Expect = 6e-36 Identities = 71/101 (70%), Positives = 86/101 (85%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 MVDLLGRAGRLK+AE FI MPI PD+L+WGTLLA+CKVHGD++L K AAEK M LE ++ Sbjct: 793 MVDLLGRAGRLKDAESFITSMPITPDALIWGTLLASCKVHGDVDLAKLAAEKAMELETHE 852 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWSFL 20 AG Y+SM+NICAD+GQW+ VLK+RS+M G V+KEPGWS L Sbjct: 853 AGTYVSMANICADMGQWDNVLKLRSEMAGTEVIKEPGWSSL 893 >ref|XP_007037324.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590667837|ref|XP_007037325.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508774569|gb|EOY21825.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508774570|gb|EOY21826.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 894 Score = 155 bits (392), Expect = 1e-35 Identities = 68/99 (68%), Positives = 88/99 (88%) Frame = -3 Query: 322 MVDLLGRAGRLKEAERFINDMPIEPDSLVWGTLLAACKVHGDIELGKRAAEKVMGLEPYD 143 +VD+LGR G+L+EAE+FIN+MPIEP++ +WGTLL+ACKVHGD+ELG+ AA+K++ LEP Sbjct: 794 IVDILGRLGKLREAEKFINNMPIEPNAFIWGTLLSACKVHGDVELGRLAAKKIIELEPCH 853 Query: 142 AGAYISMSNICADVGQWEEVLKIRSQMKGIGVMKEPGWS 26 +GAY+S+SNICAD+GQWE VL+IRS M G GV KEPGWS Sbjct: 854 SGAYVSLSNICADIGQWEGVLEIRSLMNGTGVRKEPGWS 892