BLASTX nr result
ID: Ziziphus21_contig00027411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027411 (217 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589583.2| small glutamine-rich TPR containing protein,... 67 7e-09 gb|AFK38046.1| unknown [Medicago truncatula] 67 7e-09 gb|KJB59221.1| hypothetical protein B456_009G245500 [Gossypium r... 66 9e-09 gb|KJB59220.1| hypothetical protein B456_009G245500 [Gossypium r... 66 9e-09 ref|XP_012446069.1| PREDICTED: small glutamine-rich tetratricope... 66 9e-09 gb|KHG12585.1| Sgta [Gossypium arboreum] 66 9e-09 gb|KHG12584.1| Sgta [Gossypium arboreum] 66 9e-09 ref|XP_010999382.1| PREDICTED: small glutamine-rich tetratricope... 65 3e-08 ref|XP_012078232.1| PREDICTED: hsp70-Hsp90 organizing protein 3 ... 65 3e-08 ref|XP_002306633.2| hypothetical protein POPTR_0005s19980g [Popu... 65 3e-08 ref|XP_009363156.1| PREDICTED: small glutamine-rich tetratricope... 64 3e-08 ref|XP_008367335.1| PREDICTED: small glutamine-rich tetratricope... 64 3e-08 ref|XP_008391922.1| PREDICTED: small glutamine-rich tetratricope... 64 3e-08 gb|KRH18741.1| hypothetical protein GLYMA_13G080100 [Glycine max] 64 4e-08 gb|KRH18740.1| hypothetical protein GLYMA_13G080100 [Glycine max] 64 4e-08 gb|KRH18738.1| hypothetical protein GLYMA_13G080100 [Glycine max] 64 4e-08 gb|KHN33856.1| Small glutamine-rich tetratricopeptide repeat-con... 64 4e-08 ref|XP_008219731.1| PREDICTED: small glutamine-rich tetratricope... 64 4e-08 ref|XP_007019060.1| Tetratricopeptide repeat-like superfamily pr... 64 4e-08 ref|XP_007019058.1| Tetratricopeptide repeat-like superfamily pr... 64 4e-08 >ref|XP_003589583.2| small glutamine-rich TPR containing protein, putative [Medicago truncatula] gi|657401562|gb|AES59834.2| small glutamine-rich TPR containing protein, putative [Medicago truncatula] Length = 481 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNYR+ I+KGFKK Sbjct: 242 IEIDPNYSKAYSRLGLAYYAQGNYRDAIDKGFKK 275 >gb|AFK38046.1| unknown [Medicago truncatula] Length = 420 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNYR+ I+KGFKK Sbjct: 242 IEIDPNYSKAYSRLGLAYYAQGNYRDAIDKGFKK 275 >gb|KJB59221.1| hypothetical protein B456_009G245500 [Gossypium raimondii] Length = 370 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 106 HLGVEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 H +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 176 HKSIEIDPNYSKAYSRLGLAYYAQGNYADAIEKGFKK 212 >gb|KJB59220.1| hypothetical protein B456_009G245500 [Gossypium raimondii] Length = 294 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 106 HLGVEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 H +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 230 HKSIEIDPNYSKAYSRLGLAYYAQGNYADAIEKGFKK 266 >ref|XP_012446069.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein-like [Gossypium raimondii] gi|763792223|gb|KJB59219.1| hypothetical protein B456_009G245500 [Gossypium raimondii] Length = 424 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 106 HLGVEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 H +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 230 HKSIEIDPNYSKAYSRLGLAYYAQGNYADAIEKGFKK 266 >gb|KHG12585.1| Sgta [Gossypium arboreum] Length = 424 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 106 HLGVEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 H +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 230 HKSIEIDPNYSKAYSRLGLAYYAQGNYADAIEKGFKK 266 >gb|KHG12584.1| Sgta [Gossypium arboreum] Length = 435 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 106 HLGVEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 H +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 241 HKSIEIDPNYSKAYSRLGLAYYAQGNYADAIEKGFKK 277 >ref|XP_010999382.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein alpha [Populus euphratica] Length = 412 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 VEIDP YSKAYSR+GLAYYAQGNYR+ I+KGFKK Sbjct: 226 VEIDPGYSKAYSRLGLAYYAQGNYRDAIDKGFKK 259 >ref|XP_012078232.1| PREDICTED: hsp70-Hsp90 organizing protein 3 [Jatropha curcas] gi|643723191|gb|KDP32796.1| hypothetical protein JCGZ_12088 [Jatropha curcas] Length = 435 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNYR+ I+KGF K Sbjct: 247 IEIDPNYSKAYSRLGLAYYAQGNYRDAIDKGFSK 280 >ref|XP_002306633.2| hypothetical protein POPTR_0005s19980g [Populus trichocarpa] gi|550339353|gb|EEE93629.2| hypothetical protein POPTR_0005s19980g [Populus trichocarpa] Length = 354 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 VEIDP YSKAYSR+GLAYYAQGNYR+ I+KGFKK Sbjct: 154 VEIDPGYSKAYSRLGLAYYAQGNYRDAIDKGFKK 187 >ref|XP_009363156.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein beta [Pyrus x bretschneideri] Length = 437 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 242 IEIDPNYSKAYSRLGLAYYAQGNYHDAIEKGFKK 275 >ref|XP_008367335.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein beta-like [Malus domestica] gi|658062848|ref|XP_008367336.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein beta-like [Malus domestica] Length = 313 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 242 IEIDPNYSKAYSRLGLAYYAQGNYHDAIEKGFKK 275 >ref|XP_008391922.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein [Malus domestica] Length = 448 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 242 IEIDPNYSKAYSRLGLAYYAQGNYHDAIEKGFKK 275 >gb|KRH18741.1| hypothetical protein GLYMA_13G080100 [Glycine max] Length = 321 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GL YYAQGNYR+ I+KGF+K Sbjct: 250 IEIDPNYSKAYSRLGLVYYAQGNYRDAIHKGFRK 283 >gb|KRH18740.1| hypothetical protein GLYMA_13G080100 [Glycine max] Length = 287 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GL YYAQGNYR+ I+KGF+K Sbjct: 250 IEIDPNYSKAYSRLGLVYYAQGNYRDAIHKGFRK 283 >gb|KRH18738.1| hypothetical protein GLYMA_13G080100 [Glycine max] Length = 435 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GL YYAQGNYR+ I+KGF+K Sbjct: 247 IEIDPNYSKAYSRLGLVYYAQGNYRDAIHKGFRK 280 >gb|KHN33856.1| Small glutamine-rich tetratricopeptide repeat-containing protein alpha [Glycine soja] Length = 438 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GL YYAQGNYR+ I+KGF+K Sbjct: 250 IEIDPNYSKAYSRLGLVYYAQGNYRDAIHKGFRK 283 >ref|XP_008219731.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein beta [Prunus mume] Length = 406 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 246 IEIDPNYSKAYSRLGLAYYAQGNYSDAIEKGFKK 279 >ref|XP_007019060.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 4 [Theobroma cacao] gi|508724388|gb|EOY16285.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 4 [Theobroma cacao] Length = 312 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 100 IEIDPNYSKAYSRLGLAYYAQGNYADAIEKGFKK 133 >ref|XP_007019058.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 2 [Theobroma cacao] gi|590598997|ref|XP_007019059.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 2 [Theobroma cacao] gi|508724386|gb|EOY16283.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 2 [Theobroma cacao] gi|508724387|gb|EOY16284.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 2 [Theobroma cacao] Length = 433 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 115 VEIDPNYSKAYSRMGLAYYAQGNYRNDINKGFKK 216 +EIDPNYSKAYSR+GLAYYAQGNY + I KGFKK Sbjct: 244 IEIDPNYSKAYSRLGLAYYAQGNYADAIEKGFKK 277