BLASTX nr result
ID: Ziziphus21_contig00027135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027135 (483 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014226833.1| PREDICTED: antimicrobial peptide Alo-3-like ... 62 2e-07 gb|ABC40571.1| putative antimicrobial knottin protein Btk-3 [Bem... 60 8e-07 >ref|XP_014226833.1| PREDICTED: antimicrobial peptide Alo-3-like [Trichogramma pretiosum] Length = 62 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/54 (50%), Positives = 36/54 (66%), Gaps = 2/54 (3%) Frame = -1 Query: 360 KIFFFVFAALMVLMQATEA--CLKNGKTCKANGSMGNCCSGYCHQLKGHSTGKC 205 ++F + A+++L A A CLK GK C A+GS GNCCSG+C+Q G TGKC Sbjct: 8 RLFVLMVVAMLMLSFAPSAMACLKKGKKCTASGSRGNCCSGFCNQAAGKKTGKC 61 >gb|ABC40571.1| putative antimicrobial knottin protein Btk-3 [Bemisia tabaci] Length = 59 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = -1 Query: 360 KIFFFVFAALMVLMQAT---EACLKNGKTCKANGSMGNCCSGYCHQLKGHSTGKC 205 KIF F F AL+ L ACL G +CK +GSMGNCCSG+C Q S G C Sbjct: 4 KIFVFFFLALVALSMVAVNVSACLTKGASCKGDGSMGNCCSGFCWQANPSSPGSC 58