BLASTX nr result
ID: Ziziphus21_contig00026280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026280 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992401.1| hypothetical protein Salmi_Mp135 (mitochondr... 107 3e-21 ref|YP_004222277.1| hypothetical protein BevumaM_p039 [Beta vulg... 83 7e-14 ref|XP_002529530.1| conserved hypothetical protein [Ricinus comm... 52 1e-09 >ref|YP_008992401.1| hypothetical protein Salmi_Mp135 (mitochondrion) [Salvia miltiorrhiza] gi|534292370|gb|AGU16662.1| hypothetical protein Salmi_Mp135 (mitochondrion) [Salvia miltiorrhiza] Length = 122 Score = 107 bits (268), Expect = 3e-21 Identities = 56/64 (87%), Positives = 59/64 (92%) Frame = +2 Query: 38 PPLAEAKRLKSALRNIASVGLSVQQSTSSGREGYRTYKSLPVFT*AFSYQSSSTTAVSYL 217 PPLAEAKRLKSALRN+ASVGLSVQQSTSSGREGYRTYKS+PV T A SYQSSSTTA+SY Sbjct: 56 PPLAEAKRLKSALRNLASVGLSVQQSTSSGREGYRTYKSIPVLTEALSYQSSSTTALSYS 115 Query: 218 IARR 229 ARR Sbjct: 116 PARR 119 >ref|YP_004222277.1| hypothetical protein BevumaM_p039 [Beta vulgaris subsp. maritima] gi|346683152|ref|YP_004842084.1| hypothetical protein BemaM_p037 [Beta macrocarpa] gi|317905712|emb|CBX33240.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439792|emb|CBX33292.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148721|emb|CBJ23359.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500070|emb|CBX24886.1| hypothetical protein [Beta macrocarpa] gi|384939198|emb|CBL52045.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 102 Score = 83.2 bits (204), Expect = 7e-14 Identities = 51/87 (58%), Positives = 57/87 (65%), Gaps = 2/87 (2%) Frame = +2 Query: 2 WL--PTELTLGPFRPPLAEAKRLKSALRNIASVGLSVQQSTSSGREGYRTYKSLPVFT*A 175 WL PTEL G PPLAEAKR +N+ASVGLSVQQSTSSGREGY + L F Sbjct: 18 WLRFPTELN-GLAAPPLAEAKRFGKRAKNVASVGLSVQQSTSSGREGYIVHTILLQFLRK 76 Query: 176 FSYQSSSTTAVSYLIARRGGSPFEFSK 256 + +S YLIARRGGSPFEFS+ Sbjct: 77 L-FLTSQVVQQLYLIARRGGSPFEFSR 102 >ref|XP_002529530.1| conserved hypothetical protein [Ricinus communis] gi|223531014|gb|EEF32868.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 51.6 bits (122), Expect(2) = 1e-09 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = +3 Query: 105 CNSPPVAEERVTVHTRVFQFLRKLF 179 CNSPP+AEER+T+HTRVFQFLRK F Sbjct: 36 CNSPPIAEERITIHTRVFQFLRKHF 60 Score = 37.4 bits (85), Expect(2) = 1e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +2 Query: 176 FSYQSSSTTAVSYLIARR 229 FSYQSSSTTAVSYLIARR Sbjct: 60 FSYQSSSTTAVSYLIARR 77