BLASTX nr result
ID: Ziziphus21_contig00025489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025489 (209 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD19773.1| putative retroelement pol polyprotein [Arabidopsi... 58 3e-06 emb|CAJ09951.2| putative gag-pol polyprotein [Citrus sinensis] 56 9e-06 >gb|AAD19773.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1335 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/69 (40%), Positives = 39/69 (56%) Frame = +1 Query: 1 LYVLLGKTIXXXXXXXXXXQVMDKTVLWHKMLDHISEKGLYYLNKQNVFDKDIISNLESC 180 LY+L G T +V D+T LWH L H+S+KG+ L K+ +++I LE C Sbjct: 392 LYILDGVT--EEGESHSSAEVKDETALWHSRLGHMSQKGMEILVKKGCLRREVIKELEFC 449 Query: 181 ETCILGKQH 207 E C+ GKQH Sbjct: 450 EDCVYGKQH 458 >emb|CAJ09951.2| putative gag-pol polyprotein [Citrus sinensis] Length = 1334 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/69 (43%), Positives = 37/69 (53%) Frame = +1 Query: 1 LYVLLGKTIXXXXXXXXXXQVMDKTVLWHKMLDHISEKGLYYLNKQNVFDKDIISNLESC 180 LYVL G ++ + D+T LWH L H+S KGL L+KQ + D I LE C Sbjct: 400 LYVLQGSSVPVQEGVSAVSEE-DRTKLWHLRLGHMSIKGLQELSKQGLLGGDRIQQLEFC 458 Query: 181 ETCILGKQH 207 E CI GK H Sbjct: 459 ENCIFGKSH 467