BLASTX nr result
ID: Ziziphus21_contig00025307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025307 (249 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173368.1| hypothetical protein NitaMp020 [Nicotiana tabac... 60 6e-18 ref|XP_012482084.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal pr... 60 3e-16 gb|KJB09743.1| hypothetical protein B456_001G161900 [Gossypium r... 60 3e-16 gb|ALE29228.1| ribosomal protein S14 (mitochondrion) [Heuchera p... 60 3e-16 ref|XP_010556267.1| PREDICTED: ribosomal protein S14, mitochondr... 60 8e-16 ref|YP_005090361.1| ribosomal protein S14 (mitochondrion) [Phoen... 60 1e-15 ref|XP_008790687.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal pr... 57 9e-15 gb|AGY62813.1| orf120 (mitochondrion) [Eruca vesicaria subsp. sa... 60 1e-14 gb|AHY20327.1| ribosomal protein S14 (mitochondrion) (mitochondr... 60 1e-14 ref|YP_002608356.1| ribosomal protein S14 [Vitis vinifera] gi|20... 60 4e-14 ref|XP_008244829.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal pr... 58 2e-13 gb|AHA47122.1| ribosomal protein S14 (mitochondrion) [Amborella ... 60 2e-13 ref|YP_007905721.1| ribosomal protein S14 (mitochondrion) [Lirio... 60 2e-13 ref|YP_006460159.1| ribosomal protein subunit S14 (mitochondrion... 60 2e-13 ref|YP_009045790.1| ribosomal protein S14 (mitochondrion) [Batis... 60 3e-13 ref|YP_002608213.1| ribosomal protein S14 [Carica papaya] gi|170... 58 7e-13 gb|EPS74577.1| hypothetical protein M569_00171 [Genlisea aurea] 57 1e-12 gb|ERM97419.1| hypothetical protein AMTR_s00251p00014110 [Ambore... 55 3e-12 dbj|BAJ22103.1| ribosomal protein S14 [Cycas taitungensis] 57 3e-12 ref|YP_173367.1| ribosomal protein S14 [Nicotiana tabacum] gi|92... 55 4e-12 >ref|YP_173368.1| hypothetical protein NitaMp020 [Nicotiana tabacum] gi|56806530|dbj|BAD83431.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 121 Score = 59.7 bits (143), Expect(2) = 6e-18 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 92 LTISSQFIFSCEQSTFVISYISLLRHLTEFPPNI 193 + +SSQFIFS EQSTFVISYISLLRHLTEFPP++ Sbjct: 68 IKLSSQFIFSREQSTFVISYISLLRHLTEFPPHL 101 Score = 57.8 bits (138), Expect(2) = 6e-18 Identities = 26/31 (83%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = +1 Query: 4 CK-TIVWQLGQLITMFVPHMTRKIGVFTKGF 93 CK T+ WQLGQLITMFVPH+TRKIG+FTKGF Sbjct: 37 CKGTLSWQLGQLITMFVPHITRKIGIFTKGF 67 >ref|XP_012482084.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein S14, mitochondrial [Gossypium raimondii] Length = 164 Score = 60.1 bits (144), Expect(2) = 3e-16 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 68 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 98 Score = 51.6 bits (122), Expect(2) = 3e-16 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 184 GKLSKMSEKRNI*DHKCRLLAAKYELRR 101 GKLSKMSEKRNI DHK RLLAAKYELRR Sbjct: 40 GKLSKMSEKRNIRDHKRRLLAAKYELRR 67 >gb|KJB09743.1| hypothetical protein B456_001G161900 [Gossypium raimondii] Length = 129 Score = 60.1 bits (144), Expect(2) = 3e-16 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 68 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 98 Score = 51.6 bits (122), Expect(2) = 3e-16 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 184 GKLSKMSEKRNI*DHKCRLLAAKYELRR 101 GKLSKMSEKRNI DHK RLLAAKYELRR Sbjct: 40 GKLSKMSEKRNIRDHKRRLLAAKYELRR 67 >gb|ALE29228.1| ribosomal protein S14 (mitochondrion) [Heuchera parviflora var. saurensis] Length = 120 Score = 60.1 bits (144), Expect(2) = 3e-16 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 44 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 74 Score = 51.6 bits (122), Expect(2) = 3e-16 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 184 GKLSKMSEKRNI*DHKCRLLAAKYELRR 101 GKLSKMSEKRNI DHK RLLAAKYELRR Sbjct: 16 GKLSKMSEKRNIRDHKRRLLAAKYELRR 43 >ref|XP_010556267.1| PREDICTED: ribosomal protein S14, mitochondrial [Tarenaya hassleriana] Length = 120 Score = 60.1 bits (144), Expect(2) = 8e-16 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 44 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 74 Score = 50.1 bits (118), Expect(2) = 8e-16 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 184 GKLSKMSEKRNI*DHKCRLLAAKYELRR 101 GKLSKMSEKRNI DHK RLLAAK+ELRR Sbjct: 16 GKLSKMSEKRNIRDHKRRLLAAKFELRR 43 >ref|YP_005090361.1| ribosomal protein S14 (mitochondrion) [Phoenix dactylifera] gi|343478413|gb|AEM43901.1| ribosomal protein S14 (mitochondrion) [Phoenix dactylifera] Length = 107 Score = 60.1 bits (144), Expect(2) = 1e-15 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 31 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 61 Score = 49.3 bits (116), Expect(2) = 1e-15 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 181 KLSKMSEKRNI*DHKCRLLAAKYELRR 101 KLSKMSEKRNI DHK RLLAAKYELRR Sbjct: 4 KLSKMSEKRNIRDHKRRLLAAKYELRR 30 >ref|XP_008790687.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein S14, mitochondrial [Phoenix dactylifera] Length = 120 Score = 57.4 bits (137), Expect(2) = 9e-15 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDK+RYKLSKLP NS Sbjct: 44 KLYKAFCKDPDLPSDMRDKNRYKLSKLPRNS 74 Score = 49.3 bits (116), Expect(2) = 9e-15 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 181 KLSKMSEKRNI*DHKCRLLAAKYELRR 101 KLSKMSEKRNI DHK RLLAAKYELRR Sbjct: 17 KLSKMSEKRNIRDHKRRLLAAKYELRR 43 >gb|AGY62813.1| orf120 (mitochondrion) [Eruca vesicaria subsp. sativa] Length = 120 Score = 60.1 bits (144), Expect(2) = 1e-14 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 44 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 74 Score = 46.2 bits (108), Expect(2) = 1e-14 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 184 GKLSKMSEKRNI*DHKCRLLAAKYELRR 101 GKLSKMSEK+N DHK RLLAAK+ELRR Sbjct: 16 GKLSKMSEKQNSRDHKRRLLAAKFELRR 43 >gb|AHY20327.1| ribosomal protein S14 (mitochondrion) (mitochondrion) [Brassica juncea var. tumida] Length = 120 Score = 60.1 bits (144), Expect(2) = 1e-14 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 44 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 74 Score = 46.2 bits (108), Expect(2) = 1e-14 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 184 GKLSKMSEKRNI*DHKCRLLAAKYELRR 101 GKLSKMSEK+N DHK RLLAAK+ELRR Sbjct: 16 GKLSKMSEKQNSRDHKRRLLAAKFELRR 43 >ref|YP_002608356.1| ribosomal protein S14 [Vitis vinifera] gi|209954152|emb|CAQ77588.1| ribosomal protein S14 [Vitis vinifera] gi|239764776|gb|ACS15244.1| ribosomal protein S14 [Vitis vinifera] Length = 118 Score = 60.1 bits (144), Expect(2) = 4e-14 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 42 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 72 Score = 44.3 bits (103), Expect(2) = 4e-14 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 181 KLSKMSEKRNI*DHKCRLLAAKYELRR 101 ++SKMSEK NI DHK RLLAAKYELRR Sbjct: 15 RVSKMSEKLNIRDHKRRLLAAKYELRR 41 >ref|XP_008244829.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein S14, mitochondrial [Prunus mume] Length = 119 Score = 58.2 bits (139), Expect(2) = 2e-13 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPD PS MRDKHRYKLSKLP NS Sbjct: 46 KLYKAFCKDPDXPSDMRDKHRYKLSKLPRNS 76 Score = 44.3 bits (103), Expect(2) = 2e-13 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -3 Query: 172 KMSEKRNI*DHKCRLLAAKYELRR 101 KMSEKRNI DHK RLLAAKYELRR Sbjct: 22 KMSEKRNIRDHKRRLLAAKYELRR 45 >gb|AHA47122.1| ribosomal protein S14 (mitochondrion) [Amborella trichopoda] gi|567767323|gb|AHC94309.1| ribosomal protein S14 (mitochondrion) [Amborella trichopoda] Length = 100 Score = 60.1 bits (144), Expect(2) = 2e-13 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 24 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 54 Score = 42.4 bits (98), Expect(2) = 2e-13 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 169 MSEKRNI*DHKCRLLAAKYELRR 101 MSEKRNI DHK RLLAAKYELRR Sbjct: 1 MSEKRNIRDHKRRLLAAKYELRR 23 >ref|YP_007905721.1| ribosomal protein S14 (mitochondrion) [Liriodendron tulipifera] gi|849123230|ref|YP_009153935.1| ribosomal protein S14 (mitochondrion) [Gossypium hirsutum] gi|849123273|ref|YP_009153969.1| ribosomal protein S14 (mitochondrion) [Gossypium harknessii] gi|947838300|ref|YP_009177631.1| ribosomal protein S14 (mitochondrion) [Gossypium barbadense] gi|397911889|gb|AFO69221.1| ribosomal protein S14 (mitochondrion) [Gossypium hirsutum] gi|430728014|gb|AGA54171.1| ribosomal protein S14 (mitochondrion) [Gossypium hirsutum] gi|430728051|gb|AGA54207.1| ribosomal protein S14 (mitochondrion) [Gossypium harknessii] gi|480541925|gb|AGJ90418.1| ribosomal protein S14 (mitochondrion) [Liriodendron tulipifera] gi|887515766|gb|AKQ51138.1| ribosomal protein S14 (mitochondrion) [Gossypium barbadense] Length = 100 Score = 60.1 bits (144), Expect(2) = 2e-13 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 24 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 54 Score = 42.4 bits (98), Expect(2) = 2e-13 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 169 MSEKRNI*DHKCRLLAAKYELRR 101 MSEKRNI DHK RLLAAKYELRR Sbjct: 1 MSEKRNIRDHKRRLLAAKYELRR 23 >ref|YP_006460159.1| ribosomal protein subunit S14 (mitochondrion) (mitochondrion) [Erythranthe guttata] gi|340007669|gb|AEK26533.1| ribosomal protein subunit S14 (mitochondrion) (mitochondrion) [Erythranthe guttata] Length = 100 Score = 60.1 bits (144), Expect(2) = 2e-13 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 24 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRNS 54 Score = 42.4 bits (98), Expect(2) = 2e-13 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 169 MSEKRNI*DHKCRLLAAKYELRR 101 MSEKRNI DHK RLLAAKYELRR Sbjct: 1 MSEKRNIRDHKRRLLAAKYELRR 23 >ref|YP_009045790.1| ribosomal protein S14 (mitochondrion) [Batis maritima] gi|655168564|gb|AIC83393.1| ribosomal protein S14 (mitochondrion) (mitochondrion) [Batis maritima] Length = 100 Score = 60.5 bits (145), Expect(2) = 3e-13 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP NS Sbjct: 24 KLYKAFCKDPDLPSEMRDKHRYKLSKLPRNS 54 Score = 40.8 bits (94), Expect(2) = 3e-13 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -3 Query: 169 MSEKRNI*DHKCRLLAAKYELRR 101 MSEKRNI DHK RLLAAK+ELRR Sbjct: 1 MSEKRNIRDHKRRLLAAKFELRR 23 >ref|YP_002608213.1| ribosomal protein S14 [Carica papaya] gi|170522392|gb|ACB20502.1| ribosomal protein S14 (mitochondrion) [Carica papaya] Length = 100 Score = 57.8 bits (138), Expect(2) = 7e-13 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDLPS MRDKHRYKLSKLP S Sbjct: 24 KLYKAFCKDPDLPSDMRDKHRYKLSKLPRKS 54 Score = 42.4 bits (98), Expect(2) = 7e-13 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 169 MSEKRNI*DHKCRLLAAKYELRR 101 MSEKRNI DHK RLLAAKYELRR Sbjct: 1 MSEKRNIRDHKRRLLAAKYELRR 23 >gb|EPS74577.1| hypothetical protein M569_00171 [Genlisea aurea] Length = 100 Score = 57.0 bits (136), Expect(2) = 1e-12 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KAFCKDPDL S MRDKHRYKLSKLP NS Sbjct: 24 KLYKAFCKDPDLTSDMRDKHRYKLSKLPRNS 54 Score = 42.4 bits (98), Expect(2) = 1e-12 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 169 MSEKRNI*DHKCRLLAAKYELRR 101 MSEKRNI DHK RLLAAKYELRR Sbjct: 1 MSEKRNIRDHKRRLLAAKYELRR 23 >gb|ERM97419.1| hypothetical protein AMTR_s00251p00014110 [Amborella trichopoda] Length = 165 Score = 55.5 bits (132), Expect(2) = 3e-12 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 +I KAFCKDPDLPS M DK RYKLSKLP NS Sbjct: 89 KIYKAFCKDPDLPSDMTDKRRYKLSKLPRNS 119 Score = 42.7 bits (99), Expect(2) = 3e-12 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 178 LSKMSEKRNI*DHKCRLLAAKYELRR 101 +SK SEKRNI DHK RLL AKYELRR Sbjct: 63 ISKRSEKRNIRDHKHRLLGAKYELRR 88 >dbj|BAJ22103.1| ribosomal protein S14 [Cycas taitungensis] Length = 100 Score = 57.4 bits (137), Expect(2) = 3e-12 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 93 KAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 KAFCKDP+LPS MRDKHRYKLSKLP NS Sbjct: 27 KAFCKDPNLPSDMRDKHRYKLSKLPRNS 54 Score = 40.8 bits (94), Expect(2) = 3e-12 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -3 Query: 169 MSEKRNI*DHKCRLLAAKYELRR 101 MS+KRNI DHK RLLAAKYELRR Sbjct: 1 MSKKRNIRDHKRRLLAAKYELRR 23 >ref|YP_173367.1| ribosomal protein S14 [Nicotiana tabacum] gi|927029490|gb|ALD61784.1| ribosomal protein S14 (mitochondrion) [Nicotiana tabacum] Length = 119 Score = 55.5 bits (132), Expect(2) = 4e-12 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 102 EIVKAFCKDPDLPSHMRDKHRYKLSKLPNNS 10 ++ KA CKDPDLPS MRDKHRYKLSKLP S Sbjct: 24 KLYKALCKDPDLPSDMRDKHRYKLSKLPRKS 54 Score = 42.4 bits (98), Expect(2) = 4e-12 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 169 MSEKRNI*DHKCRLLAAKYELRR 101 MSEKRNI DHK RLLAAKYELRR Sbjct: 1 MSEKRNIRDHKRRLLAAKYELRR 23