BLASTX nr result
ID: Ziziphus21_contig00025284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025284 (313 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010110479.1| hypothetical protein L484_003525 [Morus nota... 57 7e-06 >ref|XP_010110479.1| hypothetical protein L484_003525 [Morus notabilis] gi|587939952|gb|EXC26580.1| hypothetical protein L484_003525 [Morus notabilis] Length = 421 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 91 DRGWYFQVDKSLKLGMPINTAFRKALDTWA 2 + G YFQV KSLKLGMPINTAFRKALDTWA Sbjct: 275 EMGCYFQVGKSLKLGMPINTAFRKALDTWA 304