BLASTX nr result
ID: Ziziphus21_contig00025208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025208 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012070861.1| PREDICTED: dihydrolipoyllysine-residue succi... 62 2e-07 ref|XP_007020771.1| Dihydrolipoamide succinyltransferase [Theobr... 58 3e-06 >ref|XP_012070861.1| PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like [Jatropha curcas] gi|802588393|ref|XP_012070863.1| PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like [Jatropha curcas] gi|643731963|gb|KDP39155.1| hypothetical protein JCGZ_00912 [Jatropha curcas] Length = 469 Score = 61.6 bits (148), Expect = 2e-07 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 4/66 (6%) Frame = -2 Query: 194 VMFGVLRRKAASGGSFSA----SLRSYGPTVSKPRTSSILEKKEIILQPRGFGYVRNFSL 27 +M G+LRR+ ++GGS S+ SL+S P S PR SS+ EK EI+LQPRG G+VRNFS Sbjct: 1 MMLGILRRRVSAGGSSSSILKQSLQSVRPAASMPRVSSLPEK-EILLQPRGLGHVRNFSH 59 Query: 26 RIIPGC 9 + C Sbjct: 60 LVSSDC 65 >ref|XP_007020771.1| Dihydrolipoamide succinyltransferase [Theobroma cacao] gi|508720399|gb|EOY12296.1| Dihydrolipoamide succinyltransferase [Theobroma cacao] Length = 468 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 4/65 (6%) Frame = -2 Query: 191 MFGVLRRKAASGGSFSA----SLRSYGPTVSKPRTSSILEKKEIILQPRGFGYVRNFSLR 24 M G LRRK ASGGS ++ SL++ G VS R SS K+ I+LQ RG VRNFS Sbjct: 1 MLGALRRKVASGGSSASVLGKSLQAIGSGVSASRVSSNAGKEIILLQARGVALVRNFSHL 60 Query: 23 IIPGC 9 I+PGC Sbjct: 61 ILPGC 65