BLASTX nr result
ID: Ziziphus21_contig00025190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025190 (465 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272860.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 emb|CAN75780.1| hypothetical protein VITISV_012424 [Vitis vinifera] 75 1e-11 ref|XP_010112990.1| hypothetical protein L484_022712 [Morus nota... 74 4e-11 ref|XP_010099000.1| hypothetical protein L484_025660 [Morus nota... 74 4e-11 ref|XP_010246572.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 gb|KDP45912.1| hypothetical protein JCGZ_15472 [Jatropha curcas] 67 6e-10 ref|XP_012092877.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-09 ref|XP_010052003.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_007023627.1| Pentatricopeptide repeat-containing protein,... 68 3e-09 ref|XP_010678219.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_008358789.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 gb|KHN23560.1| Pentatricopeptide repeat-containing protein [Glyc... 65 2e-08 ref|XP_008231445.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_008231442.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_008231419.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_003553908.2| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_004308198.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_007220653.1| hypothetical protein PRUPE_ppa003671mg [Prun... 65 2e-08 ref|XP_008366192.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_008384594.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 >ref|XP_002272860.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360 [Vitis vinifera] gi|731431002|ref|XP_010665260.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360 [Vitis vinifera] gi|296081020|emb|CBI18524.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHEM+RRGFKPN VTYNIRIDAY KK CFG+GLRLLEE+E+AN Sbjct: 243 YHEMIRRGFKPNSVTYNIRIDAYCKK-GCFGDGLRLLEEMEKAN 285 >emb|CAN75780.1| hypothetical protein VITISV_012424 [Vitis vinifera] Length = 515 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHEM+RRGFKPN VTYNIRIDAY KK CFG+GLRLLEE+E+AN Sbjct: 243 YHEMIRRGFKPNSVTYNIRIDAYCKK-GCFGDGLRLLEEMEKAN 285 >ref|XP_010112990.1| hypothetical protein L484_022712 [Morus notabilis] gi|587948943|gb|EXC35161.1| hypothetical protein L484_022712 [Morus notabilis] Length = 548 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQANF 331 YHEMV RGF+PN+VTYNIRIDAY K C G+GLRLLEE+EQANF Sbjct: 244 YHEMVARGFRPNVVTYNIRIDAY-CKAGCLGDGLRLLEEMEQANF 287 >ref|XP_010099000.1| hypothetical protein L484_025660 [Morus notabilis] gi|587887562|gb|EXB76302.1| hypothetical protein L484_025660 [Morus notabilis] Length = 249 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQANF 331 YHEMV RGF+PN+VTYNIRIDAY K C G+GLRLLEE+EQANF Sbjct: 109 YHEMVARGFRPNVVTYNIRIDAY-CKAGCLGDGLRLLEEMEQANF 152 >ref|XP_010246572.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360 [Nelumbo nucifera] Length = 512 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHEM+RRGF PN+VTYNIRIDAY KK C G+GLRLLEE+EQ+N Sbjct: 240 YHEMIRRGFTPNVVTYNIRIDAYCKK-GCLGDGLRLLEEMEQSN 282 >gb|KDP45912.1| hypothetical protein JCGZ_15472 [Jatropha curcas] Length = 866 Score = 67.0 bits (162), Expect(2) = 6e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+VRRGFKP +TYNIRIDAY KK FG+GLR+ EE+EQAN Sbjct: 70 YHEIVRRGFKPTALTYNIRIDAYCKK-GYFGDGLRIFEEIEQAN 112 Score = 23.1 bits (48), Expect(2) = 6e-10 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 349 SGTSKFLTSGHQLFILLCRQALH 281 +G S+ + QLF +CR+ LH Sbjct: 127 AGVSRNIIKARQLFNEICRRKLH 149 >ref|XP_012092877.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like [Jatropha curcas] gi|643687224|gb|KDP20163.1| hypothetical protein JCGZ_00024 [Jatropha curcas] Length = 510 Score = 66.2 bits (160), Expect(2) = 1e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+VRRGFKP +TYNIRIDAY KK FG+GLR+ EE+EQAN Sbjct: 238 YHEIVRRGFKPTALTYNIRIDAYCKK-GYFGDGLRIFEEMEQAN 280 Score = 23.1 bits (48), Expect(2) = 1e-09 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 349 SGTSKFLTSGHQLFILLCRQALH 281 +G S+ + QLF +CR+ LH Sbjct: 295 AGVSRNIIKARQLFNEICRRKLH 317 >ref|XP_010052003.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360 [Eucalyptus grandis] gi|629110887|gb|KCW75847.1| hypothetical protein EUGRSUZ_D00236 [Eucalyptus grandis] Length = 502 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVE 343 YHEMVRRGFKPN VTYNIRIDAY K+ C G+GLRLLEE+E Sbjct: 238 YHEMVRRGFKPNTVTYNIRIDAYCKR-GCVGDGLRLLEEME 277 >ref|XP_007023627.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508778993|gb|EOY26249.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 512 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 +H+MVRRGFKPN +TYNIRIDAY KK C G+GLRLLEE+EQ + Sbjct: 245 FHDMVRRGFKPNSMTYNIRIDAYCKK-GCLGDGLRLLEEMEQVH 287 >ref|XP_010678219.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360 [Beta vulgaris subsp. vulgaris] gi|870859618|gb|KMT11037.1| hypothetical protein BVRB_5g112560 [Beta vulgaris subsp. vulgaris] Length = 515 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 +HEMV+RGFKPN VTY+IRIDAY KK CF +GLRLLEE+E+ N Sbjct: 245 FHEMVKRGFKPNNVTYSIRIDAYCKK-GCFDDGLRLLEEMERVN 287 >ref|XP_008358789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like [Malus domestica] Length = 511 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+VRRGFKPN +TYNIRIDAY KK CF +GLRL E +E+ N Sbjct: 244 YHELVRRGFKPNSITYNIRIDAYCKK-GCFADGLRLFEGMEREN 286 >gb|KHN23560.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 399 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHEMVRRGF P+ VT+NIRIDAY KK CFG+ LRLLEE+E+ N Sbjct: 127 YHEMVRRGFSPDGVTFNIRIDAYCKK-GCFGDALRLLEEMERRN 169 >ref|XP_008231445.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like isoform X2 [Prunus mume] Length = 533 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+V+RGF+PNI+TYNIRIDAY KK CF +GLRL E +E+ N Sbjct: 244 YHELVKRGFEPNIITYNIRIDAYCKK-GCFADGLRLFEGMEREN 286 >ref|XP_008231442.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like isoform X1 [Prunus mume] gi|645250927|ref|XP_008231443.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like isoform X1 [Prunus mume] gi|645250930|ref|XP_008231444.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like isoform X1 [Prunus mume] Length = 551 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+V+RGF+PNI+TYNIRIDAY KK CF +GLRL E +E+ N Sbjct: 244 YHELVKRGFEPNIITYNIRIDAYCKK-GCFADGLRLFEGMEREN 286 >ref|XP_008231419.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like [Prunus mume] Length = 527 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+V+RGF+PNI+TYNIRIDAY KK CF +GLRL E +E+ N Sbjct: 244 YHELVKRGFEPNIITYNIRIDAYCKK-GCFADGLRLFEGMEREN 286 >ref|XP_003553908.2| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like [Glycine max] gi|947043716|gb|KRG93345.1| hypothetical protein GLYMA_19G010600 [Glycine max] Length = 616 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHEMVRRGF P+ VT+NIRIDAY KK CFG+ LRLLEE+E+ N Sbjct: 317 YHEMVRRGFSPDGVTFNIRIDAYCKK-GCFGDALRLLEEMERRN 359 >ref|XP_004308198.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360 [Fragaria vesca subsp. vesca] Length = 499 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+ RRGFKPN +TYNIRIDAY K+ CF + LRL EE+E+AN Sbjct: 242 YHELARRGFKPNSITYNIRIDAYCKR-GCFADALRLFEEMERAN 284 >ref|XP_007220653.1| hypothetical protein PRUPE_ppa003671mg [Prunus persica] gi|462417115|gb|EMJ21852.1| hypothetical protein PRUPE_ppa003671mg [Prunus persica] Length = 557 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+V+RGF+PNI+TYNIRIDAY KK CF +GLRL E +E+ N Sbjct: 241 YHELVKRGFEPNIITYNIRIDAYCKK-GCFADGLRLFEGMEREN 283 >ref|XP_008366192.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like [Malus domestica] Length = 517 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+V+RGFKPN +TYNIRIDAY KK CF +GLRL E +E+ N Sbjct: 244 YHELVKRGFKPNSITYNIRIDAYCKK-GCFADGLRLFEGMEREN 286 >ref|XP_008384594.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like [Malus domestica] Length = 517 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 465 YHEMVRRGFKPNIVTYNIRIDAYRKKCDCFGNGLRLLEEVEQAN 334 YHE+V+RGFKPN +TYNIRIDAY KK CF +GLRL E +E+ N Sbjct: 244 YHELVKRGFKPNSITYNIRIDAYCKK-GCFADGLRLFEGMEREN 286